SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005052 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005052
Domain Number 1 Region: 14-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-33
Family SPRY domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005052   Gene: ENSTGUG00000004915   Transcript: ENSTGUT00000005102
Sequence length 136
Comment pep:novel chromosome:taeGut3.2.4:18:3700872:3701601:-1 gene:ENSTGUG00000004915 transcript:ENSTGUT00000005102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVLSPFHWSAYEFCISQVMCSQGFSTGCHYWEVITKDSDGWAVGVAHGMIGKRDKLGRTE
RSWCVEWLGPKKQLSVWHKDQETLLHKDKPLKVGVFMELEKKTVSFYSIADKEILLHTFE
INTSHPLYPAFWLYTL
Download sequence
Identical sequences H0Z3A9
ENSTGUP00000005052 ENSTGUP00000005052 59729.ENSTGUP00000005052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]