SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005072 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005072
Domain Number 1 Region: 45-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000518
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005072   Gene: ENSTGUG00000004927   Transcript: ENSTGUT00000005122
Sequence length 418
Comment pep:novel chromosome:taeGut3.2.4:11:4283900:4287727:1 gene:ENSTGUG00000004927 transcript:ENSTGUT00000005122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QERIVRCLLLLSVLCLAGCEGNKSELASTRGLMPGVAFRAKRSPDACLPNPCQHQGQCQV
TVDGAVCSCKPGFTGEFCQDVVLKLACEEEHMKMMVRKEVFELLKIPLELVHLKNQACKV
SEKEEEGELFFAATLTGENHTACGSVIQQNSSHVSYSNVIESEQEAHRAMISRSFQLEVH
FSCIYAYEQVVRLPFALTAVDKLVQLVVREGHFNVSMRLYKSPSYLEPYHLPSVAVPLTD
TLYVLLKMEGQHQLRYFLLSVLDCWATPSMDPHQDTQHKLIEQGCPHDETVTYLNAIGES
TAAKFSFQMFQFVGYPEVFLHCRVQLCVPDSPEPCAKQQCPRPWRSRRALADDYNRIVSY
GPILLLAAPSSGAEIHHSSTGQQDPAGPSPWLSRALILLCVLAVLTVAAAAVSVGRRM
Download sequence
Identical sequences H0Z3C9
ENSTGUP00000005072 ENSTGUP00000005072 59729.ENSTGUP00000005072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]