SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005109 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005109
Domain Number 1 Region: 434-641
Classification Level Classification E-value
Superfamily PUA domain-like 7.7e-76
Family SRA domain-like 0.0000000137
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.14e-17
Family Ubiquitin-related 0.0000734
Further Details:      
 
Domain Number 3 Region: 329-398
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000443
Family PHD domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005109   Gene: ENSTGUG00000004941   Transcript: ENSTGUT00000005159
Sequence length 722
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:63566666:63641295:-1 gene:ENSTGUG00000004941 transcript:ENSTGUT00000005159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTIDGTETQTIDDLSRLTKIECLREKIEETFRVSPDRQRLFYRGKQLEDGHTLFD
YNVGLNDIVQLLIRSDSEAPTTASVADQDGEVNPCTVSNCKNKVKKTSSGSPSQPSTSSR
SFLIDPGIGLYKINELVDARDINIGAWFEAHIENVTRATKGHKNGKAQGKSGNTYKRTNG
NLNQDHSRANVNNLDSTPSTSYSDCMDTDEEAIYHIKYDEYPENGIIEMDTVNLRPRART
ILKWSELKVGDVVMVNYNVETPEERGFWFDAEITSLREISRTNKEVHAKILLGGPEDTIN
DCKILFIEEMYKIEKPGAYPLTFGDGDFKRKSGPECKHCRADPDKECRFCSCYLCGGKQD
AHMQLLCDECNMAYHIYCLNPPLSKIPEDEDWYCPSCKNDSNEVVKAGEKLKQSKKKAKM
PSASTESQRDWGKGMACVGRTKECTIVPSNHYGPIPGVPVGTTWKFRVQVSEAGVHRPHV
GGIHGRSNDGAYSLVLAGGFEDEVDRGDEFTYTGSGGRDLSGNKRIGEHSFDQTLTHMNR
ALALNCDAPLDDKNGAESKNWRAGKPVRVVRSSKGRRISKYAPEEGNRYDGIYKVVKYWP
EIGKCGFLVWRYLLRRDDVEPAPWTSEGMERSKKLGLSVQYPEGYLEAMASKEKKDKVKK
QTVKQEPTSQKEPTNTPKAMRMGDGGKGEAFQLTQEQQWLIREDCMNQKLWDEVLVSLKE
GP
Download sequence
Identical sequences H0Z3G5
ENSTGUP00000005109 59729.ENSTGUP00000005109 ENSTGUP00000005109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]