SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005117 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005117
Domain Number 1 Region: 403-581
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-46
Family SPRY domain 0.0021
Further Details:      
 
Domain Number 2 Region: 90-155
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.72e-17
Family B-box zinc-binding domain 0.0000211
Further Details:      
 
Domain Number 3 Region: 300-408
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000112
Family Fibronectin type III 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005117
Domain Number - Region: 41-87
Classification Level Classification E-value
Superfamily RING/U-box 0.00459
Family ZZ domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005117   Gene: ENSTGUG00000004946   Transcript: ENSTGUT00000005167
Sequence length 610
Comment pep:novel chromosome:taeGut3.2.4:4A:15812135:15857266:1 gene:ENSTGUG00000004946 transcript:ENSTGUT00000005167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLQNIIDRFQKASLSGPNSPSESRRERTYRNSPTMSVAGERIACQFCEQDPPRDAVKTCI
TCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDAHFRGLTCLEHENEKVNMYCVADDQLIC
ALCKLVGRHRDHQVASLSDRFEKLKQTLETNLTNLVKRNSELENQMAKLIQICQQVEVNT
AMHEAKLMEECDELMEIIRQRKQVIAVKIKETKVMKLRKLAQQVANCRQCLERSTVLINQ
AEHILKENDHARFLQTARNVAERVAMATASSQVLIPDINFNDAFENFALDFSREKKLLEG
LDYLTAPNPPSVREELCTASHDTITVHWISEDEFSVSSYELQYTIFTGQANFISLYNSMD
SWMIVPNIKQNHYTVHGLQSGTRYIFLVKAINQAGSRNSEPARLKTNSQPFKLDPKMAHK
KLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNVFIDSGCHYWEVVVGSSTWYAI
GVAYKSAPKNEWIGKNSSSWVFSRCNNNFVVRHNNKEMLVEVHPQMKRLGVLLDYDNNAL
SFYDPANSLHLHTFEVSFILPVCPTFTIWNKSLMILSGLPAPDFIDYPEQQECNCRPQES
PYVSGMKACH
Download sequence
Identical sequences H0Z3H3
59729.ENSTGUP00000005117 ENSTGUP00000005117 ENSTGUP00000005117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]