SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005126 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005126
Domain Number 1 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.35e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.77e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 3 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005126   Gene: ENSTGUG00000004987   Transcript: ENSTGUT00000005176
Sequence length 229
Comment pep:known chromosome:taeGut3.2.4:15:1810340:1811029:1 gene:ENSTGUG00000004987 transcript:ENSTGUT00000005176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN
Download sequence
Identical sequences A0A1D5P546 A0A2C9GPB4 B5DGL7 B5G2P5 H2L6M8 Q17033
ENSTGUP00000005126 NP_001133175.1.97760 NP_001280103.1.86415 XP_004074520.1.28442 XP_005491551.1.73095 XP_005498327.1.63277 XP_005524279.1.90289 XP_008491484.1.100939 XP_008924880.1.96775 XP_008924881.1.96775 XP_008924883.1.96775 XP_008924884.1.96775 XP_008946166.1.37566 XP_009471333.1.38621 XP_009554025.1.62272 XP_009578714.1.87690 XP_009693563.1.71050 XP_009878553.1.48241 XP_009983592.1.11325 XP_009983593.1.11325 XP_009983594.1.11325 XP_009983595.1.11325 XP_009983596.1.11325 XP_009995920.1.85724 XP_009995921.1.85724 XP_009995922.1.85724 XP_009995923.1.85724 XP_009995924.1.85724 XP_009995925.1.85724 XP_010016000.1.70042 XP_010016001.1.70042 XP_010084929.1.40768 XP_010140449.1.100080 XP_010197725.1.23224 XP_010197726.1.23224 XP_010214144.1.20684 XP_010293821.1.48707 XP_010293822.1.48707 XP_010293823.1.48707 XP_010293824.1.48707 XP_010293825.1.48707 XP_010293826.1.48707 XP_010293827.1.48707 XP_010396715.1.2935 XP_012433432.1.42559 XP_012433433.1.42559 XP_012433434.1.42559 XP_012433435.1.42559 XP_013804630.1.3284 XP_013804631.1.3284 XP_013804632.1.3284 XP_014109238.1.90289 XP_014743060.1.99236 XP_014817479.1.91963 XP_015499374.1.82291 XP_015499375.1.82291 XP_015733949.1.68032 XP_016302737.1.79318 XP_017549244.1.86671 XP_017931746.1.51550 XP_018549967.1.34915 XP_019134241.1.61708 XP_019937803.1.63745 XP_021457750.1.32639 ENSORLP00000001478 ENSORLP00000001478 AGAP001971-PA 59729.ENSTGUP00000005126 7165.AGAP001971-PA 8090.ENSORLP00000001478 ENSTGUP00000005126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]