SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005139 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005139
Domain Number 1 Region: 198-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000222
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005139
Domain Number - Region: 528-578
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00196
Family Spermadhesin, CUB domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005139   Gene: ENSTGUG00000004994   Transcript: ENSTGUT00000005189
Sequence length 811
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:64843464:64854055:-1 gene:ENSTGUG00000004994 transcript:ENSTGUT00000005189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFTIFLHKADNTTVMIKLKPGLPPSCRIRMKNVIMSELKIKPGENVTFTFTCRTPEKYFI
TEIQKNIDCVSGPCPFGDVHLYPPGLPRLNRTYIWDVKASTKAGLELKFSASWLRQIEPG
ETCPDSVSYNINSCIDKATVNIGTFCRNGSVSRIKLLGGVVMSLHLPWHLPLTTSGFNIA
NRASIKRLSIIESILKGESSVTLMSPNYPLGFPEDELMTWQFVIPPNMRASVFFHNYSLS
NCERKEERVEYYIPGSPSNPEVFKLSDSQPANIAGSFNMSLQGCDQDAQNPGILRLLFQV
VVQHPQVDENVTHLVDLSKEKNVTVTIHSEGWPSHIPLMSEPICLICKDPRTCDRVLTLT
SGAVYKISFLCKDLSRLRITAEKGIGCMDIRWCQRKIYSLSVPKAITRLPIRLHTFIWKL
LATDMINIEITSPSSKLQQRVQEQRCNTSYGYSIVSATPETELNVGIFCPGGSIEKIQMR
NNITISLKTFGKGFINESIPQDLNMSFVPHIKDECIFTVSPNPKAKVYLQTPNWPHGLPP
YVSISWFVVVPSKQTARLGFSEDRMGVACETGRAYVNIKEETLGAEEIVRREDELLPQPR
NMLHSFWVNVSNCRPVDKTQLALQFWVTSADKQIDLGIILAVVAGAGVLTVIGLAVCCVK
KKKKKTQNPMVGVYNSNVNTQMPGRKGLFGKERKNNESHVYAVIDDAVVYGHLLKECNGS
VSPEVDVYRPFDGPIGSLPPSPPPFSFRKDIKRSSNTEEEPLPLTDTDQDTYTFAHQKSG
QSEDNGDANKKDKGDTSMPLLENKERDGLVE
Download sequence
Identical sequences H0Z3J5
ENSTGUP00000005139 59729.ENSTGUP00000005139 ENSTGUP00000005139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]