SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005148 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005148
Domain Number 1 Region: 38-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.54e-40
Family Laminin G-like module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005148
Domain Number - Region: 1596-1646
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.011
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005148   Gene: ENSTGUG00000004859   Transcript: ENSTGUT00000005199
Sequence length 1807
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:7378039:7510510:1 gene:ENSTGUG00000004859 transcript:ENSTGUT00000005199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRWSTRWKTRRWPWDSAVTVLITFAFLLRAAEVRGAEPVDVLKALEFHNSPEGVTRTAG
FCTNRRNSKGSDVAYRVSKTAQLSAPTKQLYPGGGFPEDFSILMTVKPKKGIQSFLLSIY
NEQGIQQVGVEVGRSPVFLFEDQNGKPAPEDYPLFRTVNIADGKWHRVAISVEKKSVTMI
VDCNKKATKPLDRSDKTVVDTNGITVFGTRILDEEVFEGEIQQLLIIADPRAAFDYCEHY
SPDCDSPVPNAAQAQDPRVDEYTPEDFIEYDYEYGDADYKETDSVTEGLPLFEETVAQTE
ANVIDGFQDYRIAENDYGPQTEAPSRATEANEQNPVEEVFAEEYITGEDYDKKTEATEYG
SRGVDLSESDLLVDGDLGEYDFYEYKEYEEKPTDSTNEEFGPGVPAETDITETSVTGHGA
YGEKGQKGEPAVIEPGMLIEGPPGPRGPVGHTGPPGLQGPVGPPGDPGERGPPGRPGLPG
ADGLAGPPGTMLMLPFRFGGDGEKGPTISAQEAQAQAILQQARIAMRGPPGPMGLTGRPG
PVGGPGAAGAKGESGEPGPQGPRGVQGAPGPSGKAGKRGRPGADGARGMPGEPGAKGDRG
FDGLPGLPGDKGNRGDRGPQGPPGLPGEDGSRKQGEDGEVGPRGLPGEAGPRGLLGPRGT
PGPPGQPGIAGIDGPSGPKGNMGPQGEPGPPGQQGIPGPQGLPGPQGPIGPPGEKGPQGK
PGLPGLPGSDGPPGHPGKEGQSGDKGALGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGE
KGEDGFPGFKGDMGLKGDRGEIGQPGPRGEDGPEGPKGRSGPSGDPGAAGPAGEKGKLGV
PGLPGYPGRQGPKGSTGFPGFPGANGEKGARGLHGKPGPRGQRGPTGPRGSRGPRGPTGK
PGPKGTSGNDGPPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGK
TGPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGVPGK
DGPAGLRGFPGERGLPGAQGPAGLKGGEGPQGPPGPMGSPGERGAAGTAGPIGLPGRPGP
QGPPGPAGEKGAPGEKGPQGPAGRDGIQGPVGLPGPAGPSGSPGEDGDKGEIGEPGQKGS
KGDKGDNGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGPRGFPGPPGPIGL
QGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSIGSVGGVGEKGEPGE
AGNPGPPGESGTAGPKGERGEKGEAGPPGAAGPPGAKGPPGDDGPKGNPGPVGFPGDPGP
PGEPGPAGQDGGGGEKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGATGAEGRQGEKGA
KGEPGAEGAPGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGMPGAPGQGGPPGPLGPPGL
PGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGSPGAKGDAGISGPAGPLGP
PGPPGLPGPQGPKGSKGSSGPAGQKGDNGLPGPPGPPGPPGEVIQPLPIQSPKKTRRSPD
YMLSDAGDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQNNPARTCKDLQLCHPDFPD
GEYWIDPNQGCSGDSFKVYCNFTAGGETCIYPDKKSEGVRISSWPKENPGSWFSEFKRGK
LLSYLDVEGNSINMVQMTFLKLLSASARQNFTYNCHQSVAWHDAPSDSYDKALRFLGSND
EEMSYDNNPYIKALHDGCASRKGYAQTVLEINTPKIDQVPIVDVMINDFGDQNQKFGFEV
GPVCFLG
Download sequence
Identical sequences H0Z3K4
59729.ENSTGUP00000005148 ENSTGUP00000005148 ENSTGUP00000005148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]