SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005188 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005188
Domain Number 1 Region: 316-542
Classification Level Classification E-value
Superfamily vWA-like 1.75e-58
Family Integrin A (or I) domain 0.00024
Further Details:      
 
Domain Number 2 Region: 2-189
Classification Level Classification E-value
Superfamily vWA-like 2.49e-57
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 192-312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-17
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 4 Region: 551-598
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000353
Family Chicken cartilage matrix protein 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005188   Gene: ENSTGUG00000005029   Transcript: ENSTGUT00000005240
Sequence length 602
Comment pep:novel chromosome:taeGut3.2.4:20:6294525:6299114:1 gene:ENSTGUG00000005029 transcript:ENSTGUT00000005240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCRTGPLDIVFVIDSSRSVRPFEFETMRRFMMDIIGNLDVGPNATRVGVIQYSSQVQNIF
SLKTFFTRADMERAINSIIPLAQGTMTGLAIQYAMNVAFTTQEGARPLHKRIPRIAIVVT
DGRPQDRVTEVATQARNAGIEIYAVGIQRADMNSLRAMASPPLEEHVFLVESFELIQQFA
KQFQDKLCGVDMCMGREHGCQHSCVSTPGSFYCECNPGYRLNVDGKTCSPIDACADGSHG
CQHHCVSTRGSYSCRCRPGYYLSHNKRSCTMIDYCSFGNHSCQHECVSIPNGHYCRCRSG
FTLQPDSKSCRATDLCNGVDHGCEFKCVSTEGSYHCVCPEGQQLQADGKTCSKCGAGHVD
LVMVIDGSKSVRPQNFELVKQFVNRIVDLLEVSPHGTRVGLVQYSSRVRTEFPLNKYHSA
DEIKKAVMDVEYMEKGTMTGLALKHMVEHSFSELEGARPLSYNIPRIGLVFTDGRSQDDI
SEWARRAKESGIVMFAVGVGKAVEEELRAIASEPVEQHFSYSADFTTMTHLVENFSLNIC
PEEGKGETEIRSPCECEALVQFQTNTVAILQSLTEKNILWARSLAQMTARLEDLEKQIAN
KK
Download sequence
Identical sequences H0Z3P4
ENSTGUP00000005188 59729.ENSTGUP00000005188 ENSTGUP00000005188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]