SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005227 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005227
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000581
Family Ubiquitin-related 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005227   Gene: ENSTGUG00000005066   Transcript: ENSTGUT00000005279
Sequence length 382
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:4397362:4403932:1 gene:ENSTGUG00000005066 transcript:ENSTGUT00000005279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPLALLVRSPAQRHRDLRLSAQPAWTVRRLKTELRRLLPDAPLEEDQKLIYSGKLLLDHQ
CLGELLPKHGEVHALHLVYNLKTPANMQGTKSEVIKLNSESWALQQQHIIASTVHQCLER
RINLVFGYTKLQKLIYIHPFQHPFQSVAPGFSAYTTYSMLQMSWFQQIYARQYYMQYLAS
TAASADPSRARHSQEIPVAPVTPPAPLPDPFPAQNQPGNQNVAAQVNAVADQNLRMNAQG
GPLMEEDEEGGNRDWLDWLYSATLLYVFVNMVYFYSSISRLLLVMGGTVLMYLHHAGRFP
FRRRPVQPFPGNVPPQAALNQDQNNNFQGENGGRTNESEAPPEGQASQELQQASPSLVST
VWVFFKTFFASLLPEGPGLTRN
Download sequence
Identical sequences H0Z3T3
ENSTGUP00000005227 ENSTGUP00000005227 59729.ENSTGUP00000005227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]