SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005256 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005256
Domain Number 1 Region: 342-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 2 Region: 275-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000352
Family EGF-type module 0.059
Further Details:      
 
Domain Number 3 Region: 398-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 13-154
Classification Level Classification E-value
Superfamily Sialidases 0.0000795
Family Sialidases (neuraminidases) 0.075
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005256
Domain Number - Region: 450-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000614
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005256   Gene: ENSTGUG00000005108   Transcript: ENSTGUT00000005308
Sequence length 481
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:7197480:7244288:1 gene:ENSTGUG00000005108 transcript:ENSTGUT00000005308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLAMGQYDICKSWVTTDDGPSWEFYACQPKAMRMKDYVTVRVDPAGITCGDPPERFCTHE
NPYLCSDECDASNPDLAHPPKLMFDSEDEGLATYWQSVTWRRYPEPLLANITLSWNKSIE
LTDDIVITFEYGRPTIMMLEKSLDNGRTWHPYQYYADDCMEAFSMPARRVRDLSTTSANR
VLCTEEYSRWAGSKKEKTVRFEVRDRFAIFAGPDLKNMDNLYTRLESAKGLKDFFTVTDL
RMRLLRPALGGTYVQRENLYKYFYAVSNIEVTGRCKCNLHANLCTFKEGSLQCECEHNTT
GQDCGKCKKNFRSRSWRAGSYLPLPNGSPNACNCPLLSPTDCECYGHSNRCSYIDFLNVV
TCVSCKHNTRGQHCQHCRLGFYRNSSAELDDENVCIECNCNQIGSMHDRCNETGYCECRE
GATGPKCDDCLPNYYWRQGCFPNVCDDELLLCQNGGTCYQNQRCICPVGFKGVLCQQSRC
E
Download sequence
Identical sequences H0Z3W2
ENSTGUP00000005256 59729.ENSTGUP00000005256 ENSTGUP00000005256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]