SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005281 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005281
Domain Number 1 Region: 256-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-23
Family Laminin G-like module 0.087
Further Details:      
 
Domain Number 2 Region: 73-185
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000528
Family Cadherin 0.0042
Further Details:      
 
Domain Number 3 Region: 27-85
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000828
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005281   Gene: ENSTGUG00000005091   Transcript: ENSTGUT00000005333
Sequence length 857
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:114259:200146:-1 gene:ENSTGUG00000005091 transcript:ENSTGUT00000005333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTGEICAFKIHGQEMPFEAVVLNKTSGEGQLRAKSPIDCELQKEYTFIIQAYDCGSGPGG
TNWKKSHKAVVHIQVKDVNEFSPAFKESIYKASVTEGKIYDSILQVEATDEDCSPQYSQI
CNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQQQYDIMVTAFDCGQKHATEDVLVRVNVKP
MCKPGWQDWNKRIEYRPGSGSIPLFPSIQLEMCDGPVSSIHTTIELQTNYIGKGCDRETY
SEKYLQKLCGASSGAIDLLPSPSTTTNWTVGLLIDSNDMIFKFDGKQGAKIPDGIVPKNL
TDQFTITLWMKHGPSPGLRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQAD
TFRPAEFHWKLDQICDKEWHYYVVNVEFPVVTLYMDGTTYEPYLVTNDWPIHPSHIAMQL
TVGACWQGGEVTKPRFAQYFHGSLAGLTIRPGKIESQKVISCLQACKEGLDINSLESLGQ
GIKYHFNPSQSVLVMEGDDVENINQALQKVSYINSRQFPTAGARRLKVSSKVQCFGEDIC
ISIPDIDAYVMVFQANEPKITITGMDHFARPAAQFESERGVILLPDIRIVSTVSKMEHSA
DLREIGRANKQVAVKEMLHNLDFCDVLVIGAELDPEQECLELDHGELQGKHLDATNSTAG
YSIYGVDSMFSYEQVLRQLRYRNWGTSATLERKFRVKCSELNGRYSSNEFNLEVNILHSS
NSNFMDHINHIIFQPKFLQSVQHPEGSVSPVHSSVVPSVAMIVIIICVSILVLVVTLGVF
QLCSARQHSSMGHEGTKEIEMDWDDSALTITVNPMEKYEKPHQTEEESEEEDIDDEEEDT
TSAESDDSEEEEEEEEE
Download sequence
Identical sequences H0Z3Y7
ENSTGUP00000005281 ENSTGUP00000005281 59729.ENSTGUP00000005281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]