SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005317 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005317
Domain Number 1 Region: 287-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000022
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 2 Region: 343-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000326
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 3 Region: 406-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 97-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000826
Family Galactose-binding domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005317   Gene: ENSTGUG00000005165   Transcript: ENSTGUT00000005370
Sequence length 472
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:4351976:4418144:1 gene:ENSTGUG00000005165 transcript:ENSTGUT00000005370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRGAEAPLALLLAAAWLAQPLRGGYHGVNMFAVQSAQPDPCYDEHGLPRRCIPDFVNS
AFGKEVKVSSTCGKPPSRYCVVTEKGEEQVRTCHLCNASDPKRAHPPSFLTDLNNPHNLT
CWQSDSYVQYPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIHKSMDYGKTWVPFQFYS
TQCRKMYNKPSRAAITKQNEQEAVCTDSHTDVRPLSGGLIAFSTLDGRPTAHDFDNSPVL
QDWVTATDIRVTFSRLHTFGDESEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVRDR
DDSLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELFK
LSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKECDCHPVGAAGQTCNQ
TTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPAAPPTTAASSAEEPA
Download sequence
Identical sequences H0Z423
59729.ENSTGUP00000005317 ENSTGUP00000005317 ENSTGUP00000005317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]