SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005324 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005324
Domain Number 1 Region: 182-305
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 6.93e-60
Family Dystroglycan, domain 2 0.000000579
Further Details:      
 
Domain Number 2 Region: 499-601
Classification Level Classification E-value
Superfamily Cadherin-like 4.39e-17
Family Dystroglycan, N-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 2.51e-16
Family Dystroglycan, N-terminal domain 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005324   Gene: ENSTGUG00000005169   Transcript: ENSTGUT00000005377
Sequence length 896
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:4964949:4979783:1 gene:ENSTGUG00000005169 transcript:ENSTGUT00000005377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMTVGCLLQAPVLGRTWLPVLLLAASAHCHWPSEPAEVVRDWENQLEASMHSALSELREA
VPAVVGIPDSSAVVGRYFRVSIPTDLIASNGEVVQISEAGKDSLPSWLHWNAESSSLEGL
PLDTDKGVHYISVTTLQPFPNGSYVPQTTNVFSVEVHQEDHNEPQSVRVAVQDTSDTAPF
VCGSEEPVTILTVILDADLTKMTPKQRIELLNRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLSQNSVPNISKVEAPAKEGTMSARLGYPVVGWHIA
NKKPHLPKRMRRQINATPTPLTAIGPPTTAAQEPPTRIVPTPTSPAIAPPTETTAPPVRE
PIPLPRKPTVTIRTRGPIVQTPTLGPIQPTRVTEGTGTASVPIRPTMPGYIEPTAVITPP
STTTKKPRVSTLKPATPSTTDSSTAITRRPTRRPKTPRPTKPPSSTRSPISKLTTASPPS
RVRTTASGLPRPWEPNEPPKLTNHIDRVDAWEGTYFEVKIPSDTFYDKEDTTTDKLQLTL
KLKEQQMIEENSWVQFNSTSQLMYGMPDHNHIGKHEYFMYATDKGGLFAVDAFEIHVHKR
PHGDKSPVKFKARLEGDHNAVVNDIHKKIMLVKKLALAFGDRNSSTITVQDIAKGSIVVE
WTNNTLPLEPCPREQIRTLSKKIADDSGRPSPAFSNVLQPEFKPLNVSVGSGSCRHIQFV
PVTKDGRVISEATPTVAAGKDPEKSSEDDVYLHTVIPAVVVAAILLVAGIIAMICYRKKR
KGKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPET
TPLNQDTIGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences H0Z430
ENSTGUP00000005324 ENSTGUP00000005324 59729.ENSTGUP00000005324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]