SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005348 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005348
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-51
Family SPRY domain 0.0000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005348   Gene: ENSTGUG00000005203   Transcript: ENSTGUT00000005401
Sequence length 171
Comment pep:novel chromosome:taeGut3.2.4:Z:64154435:64164811:-1 gene:ENSTGUG00000005203 transcript:ENSTGUT00000005401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDVTLDPATAGPEVILSEDLKEATWGRPQCQWPEGPGRFDTDPCMLGSEGFTSGRHYWEV
EANGRFWAVGVARESVRRKGRVLFKPNTEIWGLQKYDELCVALTAPSNTSVPLLNGEIGV
YLDYEVGQVSFYAVSSRQRIFTFPVASFSGERVFPYFCLWVCKKKPFLLCS
Download sequence
Identical sequences H0Z454
ENSTGUP00000005348 ENSTGUP00000005348 59729.ENSTGUP00000005348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]