SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005355 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005355
Domain Number 1 Region: 563-669
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-28
Family Cadherin 0.00072
Further Details:      
 
Domain Number 2 Region: 251-355
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-28
Family Cadherin 0.0022
Further Details:      
 
Domain Number 3 Region: 142-244
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.00041
Further Details:      
 
Domain Number 4 Region: 31-136
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-26
Family Cadherin 0.00065
Further Details:      
 
Domain Number 5 Region: 460-570
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-25
Family Cadherin 0.002
Further Details:      
 
Domain Number 6 Region: 664-754
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-23
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 356-466
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 8 Region: 1-43
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000385
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005355   Gene: ENSTGUG00000005198   Transcript: ENSTGUT00000005408
Sequence length 754
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:27946610:28062358:-1 gene:ENSTGUG00000005198 transcript:ENSTGUT00000005408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDRERTDVHRLVVEAWDGGSPRRRGRLRVSVRVLDENDNAPAFSRGEYRARLREDAPPGT
AVCRLRATDPDLGANGEVRYAINRRQSDPDGYFAVEERSGVLRLRRPLDREARALHRLVV
EARDGGAQPEPRFARALVFFSIEDINDNQPVFEQDIYVTSISSHTQPGAEIINVVATDRD
SGIFGILSYLICSGDPHGKFSVDPQFGIIRTKKQLDHEAQSEYTLQIAAEDCGSPPLTSL
LTLTTRQMLYINDNSPSFMSSPLSYVMEDVEVGCLVHHIIAKDPDEGRNGQVTYHILSGN
ENKAFVLDKITGLLTTAQFLDREVQECYSLTVIALDDGSPALSATQVLTIIVLDVNDETP
RFLKQLYETAVHENRDPGEFVIRVEAVDRDAGLNSLLQYEILPGPGYEKFKMNSDSGELV
TAASLDRETQEQFEISINASRVGTESDSSAQLYLTVLDENDHSPLFAKTQYQISVTEDLE
EGSAILDLSASDEDAGLNGEVMYSLIDDTYGAFAIDSVTGSIITTKALDREIKSQYTFRA
VASDCSTHFPKSTTVMTVLIQDVNDNAPKFEQSYYKASVWEGQSPKTDIVQVFATDLDSG
LNGETEYSIVSGNENATFLIDSVRGILAANTGLDYETTSSYRFLVLLASDHGTPSLNSTA
TVLITVLDVNDNPPVFSSSEYHVHVKESIPIGSHITEVSAKDCDAGTNAEITYAIISGND
RGYFGLDGRTGSVNLTEMLDYEDTMKFTLVIQAT
Download sequence
Identical sequences H0Z461
ENSTGUP00000005355 ENSTGUP00000005355 59729.ENSTGUP00000005355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]