SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005362 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005362
Domain Number 1 Region: 16-234
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-53
Family Eukaryotic proteases 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005362   Gene: ENSTGUG00000005215   Transcript: ENSTGUT00000005415
Sequence length 234
Comment pep:novel chromosome:taeGut3.2.4:5:4688138:4702830:-1 gene:ENSTGUG00000005215 transcript:ENSTGUT00000005415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCGQKVQETSPWSCFVLFTLVAGGNQVKQGSHPWQVSLKRRQKHFCGGTVVSAHWVFTAA
LCTLYRDLLQYLHVTAGEHGLGLRGSSEQTLSVTSVIQHPKCDPRTPMNYDIALLKLDGT
FSFSSLVLPACLPHPGENFEAGYICTPCGWGHLKKNGLLSQVLYEVNPPNPNSRKCSRAL
STFRSPIQGDTTMCAGFPAGGRDACVLGSVSLCAKNSGFYTLHGITSWGLGCGR
Download sequence
Identical sequences H0Z468
ENSTGUP00000005362 ENSTGUP00000005362 59729.ENSTGUP00000005362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]