SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005363 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005363
Domain Number 1 Region: 492-657
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.75e-70
Family A middle domain of Talin 1 0.000000312
Further Details:      
 
Domain Number 2 Region: 757-892
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.71e-53
Family I/LWEQ domain 0.00000208
Further Details:      
 
Domain Number 3 Region: 662-786
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.09e-51
Family I/LWEQ domain 0.0000047
Further Details:      
 
Domain Number 4 Region: 2298-2488
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.63e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1842-1976
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.51e-47
Family VBS domain 0.00000755
Further Details:      
 
Domain Number 6 Region: 1228-1364
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.41e-41
Family VBS domain 0.024
Further Details:      
 
Domain Number 7 Region: 198-312
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-31
Family Second domain of FERM 0.00000145
Further Details:      
 
Domain Number 8 Region: 1077-1210
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.39e-28
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 313-403
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-24
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1473-1558
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000405
Family I/LWEQ domain 0.0087
Further Details:      
 
Domain Number 11 Region: 2008-2135
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000581
Family VBS domain 0.015
Further Details:      
 
Domain Number 12 Region: 82-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000875
Family Ubiquitin-related 0.062
Further Details:      
 
Domain Number 13 Region: 1699-1817
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000251
Family VBS domain 0.032
Further Details:      
 
Domain Number 14 Region: 947-1045
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000471
Family I/LWEQ domain 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005363
Domain Number - Region: 1586-1662
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000149
Family VBS domain 0.036
Further Details:      
 
Domain Number - Region: 2110-2231
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0275
Family I/LWEQ domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005363   Gene: ENSTGUG00000005039   Transcript: ENSTGUT00000005416
Sequence length 2543
Comment pep:novel chromosome:taeGut3.2.4:10:3899226:3985853:-1 gene:ENSTGUG00000005039 transcript:ENSTGUT00000005416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMVALSLKICVRQCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDDDPR
KGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICS
RIGITNYEEYSLIQESIEEKKEESTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHS
RTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACE
FGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYTKQRGAEKRIFQEHKNCGEMTEIEAKV
KYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGVTKDSVMRVDEKTKEVLQEWPLTTV
KRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEE
STMLEESVSPKKPTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNVGIMPSPQQQVT
TGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQADLSEVDNLPPLGQDMASRVWVQNKV
DESKHEIHSQVDAITAGTASVVNLTAGDPVDTDYTAVGCAITTISSNLTEMSKGVKLLAA
LMDDEVGSGEDLLKAARTLASAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGELLRQIG
ENETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQL
VACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATDDSELLKQVSAAASIVSQ
ALGDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDL
VNAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEG
LRVATNAAAQNAIKKKIVNRLEIAAKQAAAAATQTIAASQNAAVSNKNTAAHQQLVQSCK
NVADHIPQLVQGVRGSQAQAEDLSAQLALINSSQNFLQPGSKMVASAKAAVPTVTDQAAA
MQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVDGQLK
PLPGETLEKCTQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARG
VAASTSDPVAAHAMLDSARDVMEGSAMLIQEAKQALAAPGDADSQQRLAQVAKAVSHSLN
NCVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSSKSFQEAQSELNQAAADLNQSAGEVV
HATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKSISMASSKLLL
AAKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGML
DNPNEPVSDLSYFDCIEGVMENSKVLGESMAGISQNAKTGDLLVFGECVGVASKALCGLT
EAAAQAAYLVGISDPNSQAGQQGLVDPIQFARANQAIQMACQNLVDPASSPSQVLSAATI
VAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRNK
CRIATAPLIEAVENLTAFASNPEFVSIPAQISTEGSQAQEPILVSAKTMLESSSLLIKTA
RSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDFSIDGINRCIRDIEQ
ASLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASY
FEPLVLAAVGVASKTLNHQQQMTVLDQTKTLAESALQILYAAKEGGGNPKHASHTHDAIT
EAAQLMKEAVDDIMVTLNEAASEVGMVGGMVDSIAEAMNKLDEGTPPEPKGTFVDYQTTV
VKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTNDYGHLALQGRMAAATAEPEEIGFQIR
TRVQELGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQA
CITAASAVSGIIADLDTTIMFATAGTLNAENNESFADHRENILKTAKALVEDTKLLVSGA
ASSQDKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLIGA
TKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQEL
TVFQSSEVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVADMLT
ACKQASYHPDVSEEVRERALRFGTECTLGYLELLEHVLLILQKATPELKHQLASFSKRVA
AAVTELIQSAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADE
TLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAADDGQWSQGLISAA
RMVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADHDSEAMRRLQ
AAGNAVKRASDNLVRAAQKAAFGKAEDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEA
RKKLAQIRQQQYKFLPTELREDE
Download sequence
Identical sequences H0Z469
59729.ENSTGUP00000005363 ENSTGUP00000005363 ENSTGUP00000005363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]