SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005377 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005377
Domain Number 1 Region: 319-485
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-29
Family SPRY domain 0.06
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily RING/U-box 0.00000746
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005377
Domain Number - Region: 154-282
Classification Level Classification E-value
Superfamily ARM repeat 0.000152
Family Clathrin adaptor core protein 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005377   Gene: ENSTGUG00000005197   Transcript: ENSTGUT00000005431
Sequence length 575
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:4538020:4559547:1 gene:ENSTGUG00000005197 transcript:ENSTGUT00000005431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVVALVVFYASRSLFQGLLLTLEHHIPHFLGALGAGSMGNSCVCRDDSGAEDNGNSQGR
QTENSRTHIPEARSHPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEP
PYSMITLHEMAETDEGWLEVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTEI
LNLSGAAACQDACHPAKHRNTTAVLGCLAEKLAGPASIGLLSPGILEYLLHSLNFQSHPT
VMLFALIALEKFAQTSENKMTVSESCISDQLILLEKWTDNPDYLKRQVGFCAQWSLDNLF
LKEGRQFTYEKVDLTNIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDSGVW
YYEVTVITSGVMQIGWATKDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHSHPC
WKEGDTIGFLLDLQEKQMIFYLNGNQLPAEKQVFSSAVSGFFAAASFMSYQQCEFNFGAK
PFKYPPPMKFSTFNDHAFLTAEEKIILPRHRRLALLKQVSIRENCCTLCCDEVADTELRP
CGHSDLCMECALQLETCPLCRQEIQTRVRQISHIS
Download sequence
Identical sequences H0Z483
XP_002198060.1.42559 59729.ENSTGUP00000005377 ENSTGUP00000005377 ENSTGUP00000005377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]