SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005462 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005462
Domain Number 1 Region: 105-261
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-33
Family SPRY domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005462   Gene: ENSTGUG00000005277   Transcript: ENSTGUT00000005516
Sequence length 1214
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:5051913:5093312:-1 gene:ENSTGUG00000005277 transcript:ENSTGUT00000005516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRGAGTAFSSKNYRLSTEPEKSKVTGIVNSRLLNDYLHRVFTSADGNQPAAAYRKNLT
FQNLQEHLERLLSEENGSEDSRDQVAEGRLGPSTVVLDHTSGFEGLLLVDDDLLGVIGHS
NFGSIRATTCVYKGKWIYEVLISSQGLMQIGWCTLNCRFNQEEGVGDTPDSYAYDGNRVR
KWNVTTTNYGKSWAAGDIVSCLIDLDEGTIAFCLNGISLGTAFDNITRGAGMAYFPAISL
SFKESVAFNFGSRPLRYPLVEGYRPLQDPPVADLVKARKLLGYLKNVIHIGIDVTEGKLV
EKDTSMWQLQGEPTVLITLAHIFNYFSPLMCKVYLVEDVLMTFLLSILERGGAVEAHPLI
QQLLNLMWLLMEEYEVHECLKQLLMSLLRAYRFSPIIPDLGLQIHYLRLTIAVLKHEKSR
KYLLSNVLFDVLRSVVFFYIKSPLRVEEAGLQELIPTTWWPNRFTKEGKESKEVKEESAE
ERLRRRAYERGCQRLKKRIEVVEGLQVQILKLLLNNKDRGGGEASRYIFLNKFRKFLQEN
ASNRGNLAVLCPPEYMVCFLHRLIAALRYFWDGHKAKTPASLSSEGAYVPPQLFYNGKVD
YFDLQRLGGLLSHLKKTLKDDLAAKANILIDPAELQAVTMDDLDEDEESATSAAQRPSAA
LAIGGALARPAWLSSPTLGRANRFLSTAAVSLMNPRRPLGTLEKIKVLTLRTEQRTREDI
EGTHGNEGLLLGRPPEEPDQPITENSLLEVLDGIVMMYNLSVHQQLGKMVGVSDDVNEYA
MALKDTEEKISRCPKRRRDIHEELLKSQKVFSEKLNHLSRRLAWINVTIYSKEKMQDIYW
LLRVCIRTIEHGDRTGSLFAFMPEFYLSVAMNSYSALKNYFSPVNSMEELPGYEETLMRL
AAILAKHFADSRIVGTDIRDSLMQALASYVCYPHSLRAVERIPEEQRISMMKNLLAPYEQ
RPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPEDASLPSLQKPCPSTLLQRHMAHLLR
SDRDLAPSFLNSVLNQLNWAFSEFIGMIQEIQQAAERLERNFVDSRQLKVCATCFDLSVS
LLRVLEMTVTLAPEIFLDWNRPSSELLLRRLAQLLNQVLNRVTAERNLFDRVVNLRLPGL
ESVDHYPILVAVTGILVRLLVDTDVQGTERATTVLLADPCFQLRSIQYLLGHAEPSALAA
AAPPTDKRHFSLHT
Download sequence
Identical sequences H0Z4G7
ENSTGUP00000005462 59729.ENSTGUP00000005462 ENSTGUP00000005462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]