SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005484 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005484
Domain Number 1 Region: 1-238
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.66e-73
Family Eukaryotic proteases 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005484   Gene: ENSTGUG00000005327   Transcript: ENSTGUT00000005538
Sequence length 241
Comment pep:novel chromosome:taeGut3.2.4:Z:64642138:64643947:-1 gene:ENSTGUG00000005327 transcript:ENSTGUT00000005538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGGTAVQTGAWAGIVSIQDPWEPGTGHICGGSLISTEWVLTAAHCFINARNTNMWHVVAG
ATQLTQLGPEVQVRQIKQLLVHEHYIPGEERNNIALLKLDQPVVCSHYVQLGCVPDLTLK
VSELGNCYIAGWGTTTTRAERPSDVLQEANVHLIDVHLCNSSLWYTGAIHTQNLCAGYSE
GGINPCQADSGGPLVCKDNNAAFFWLVGVASWGKSCARTNQPGVYTSVQHFYDWILVQID
P
Download sequence
Identical sequences H0Z4I9
59729.ENSTGUP00000005484 ENSTGUP00000005484 ENSTGUP00000005484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]