SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005489 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005489
Domain Number 1 Region: 708-1061
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.53e-93
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000912
Further Details:      
 
Domain Number 2 Region: 534-702
Classification Level Classification E-value
Superfamily ARM repeat 9e-58
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000349
Further Details:      
 
Domain Number 3 Region: 123-296
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.61e-50
Family Ras-binding domain, RBD 0.0064
Further Details:      
 
Domain Number 4 Region: 331-496
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.94e-45
Family PLC-like (P variant) 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005489
Domain Number - Region: 20-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0421
Family Ubiquitin-related 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005489   Gene: ENSTGUG00000005286   Transcript: ENSTGUT00000005543
Sequence length 1071
Comment pep:novel chromosome:taeGut3.2.4:9:922964:968091:1 gene:ENSTGUG00000005286 transcript:ENSTGUT00000005543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFDSTMPPAVTDSLDIWAVDSQIAADGSISVDFLLPTGIYINLDVPRDATISQIKQLLW
KQAHSYPLFHLLMEIDSYMFSCVNQTAVHEELEDETRRLCDVRPFLPVLKLVTRNCDPGE
KVSKIGVLNSNSLHEFDALQDPEVNDFRAKMRRISEEKIQSLVGLSWMDWLKHTYPPEQE
TVIPESFQDKLYSGNLVVAVHFDNCQDVFSFQVSPNMNPIKLNELAIRKRLTIHGKEDEE
VDPADYVLQVSGRLEYVFGDHPLIQFQYIRNCVMSRTLPQLTLVECCTIKKMCEQEMIAI
EAAINRKSSNLPLPLPPKKTRATTSVWDISNPFKIILLKGNKLNTEENAKVHVRAGLFHG
TELLCKTIVSTEISGRSDHVWNEVLEFEINVCDLPRMARLCFAVYAVMDKMKTKKSTKAM
NPSKYQTIRKAGKVHYPVAWVNTMVFDYKGHLRNGELVLHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIRFQEYSKQPINYPPFDKILEKAAEIARNSDNAAMAGRGGKKFYVVLK
DIMERDPLSQLCENEMDLIWTLRYDCRENFPQSLPKLLLSLKWNKLEDVAQLQALLQIWP
KLLPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRF
LLERALGNRRIGQMLFWHLRSEVHIPAVSVQFGLILEAYCRGSVAHMKVLAKQVEALNKM
KTLNSLIKLNAMKQSKAKGKDAMHTCLKQNAYREALSDLQSPLNPSVILSELHVEKCRYM
DSKMKPLWIVYNNKMFGGDLVGIIFKNGDDLRQDMLTLQILRLMDILWKEAGLDLRILPY
GCLATGDHSGLIEAVSSSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNLGDDLDRAIE
EFTLSCAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFI
LTYDFIHVIQQGKTGNTEKFGRFRQYCEEAYLILRKHGNLFITLFALMLTAGLPELTSIK
DIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
Download sequence
Identical sequences H0Z4J4
ENSTGUP00000005489 ENSTGUP00000005489 59729.ENSTGUP00000005489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]