SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005524 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005524
Domain Number 1 Region: 12-260
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.82e-85
Family Eukaryotic proteases 0.00000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005524   Gene: ENSTGUG00000005352   Transcript: ENSTGUT00000005578
Sequence length 262
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:4799938:4801852:-1 gene:ENSTGUG00000005352 transcript:ENSTGUT00000005578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSFWATLVPCASPAGCGVPAISPSIAYSERIVNGQNAVPGSWPWQVSLQTTSGSHFCGG
SLINENWVVTAAHCNFNPRSHVVVLGEYNLASSAEAVQVKTVSRAITNPGWNSKTMNNDI
TLLRLSTPAKLGSRVSTICLAPANLVLPSNARAVTTGWGRTNPNSQALATALQQVTLPLI
PQNKCMQYWGNRITNAMLCAGGAGATSCQGDSGGPLVYQTGNGWTLIGIVSWGSSDCNIN
TPAIYTRVSQFRNWIDTTVAQG
Download sequence
Identical sequences H0Z4M9
59729.ENSTGUP00000005524 ENSTGUP00000005524 ENSTGUP00000005524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]