SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005542 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000005542
Domain Number - Region: 18-71
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0249
Family Transforming growth factor (TGF)-beta 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005542   Gene: ENSTGUG00000005390   Transcript: ENSTGUT00000005597
Sequence length 165
Comment pep:novel chromosome:taeGut3.2.4:19:6349268:6350890:1 gene:ENSTGUG00000005390 transcript:ENSTGUT00000005597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKGRESHEEINITFTLPAAWNSDDCVLHGHCEQVVFTTCMTVTAASNVFPVTVQPPHCVP
ETYSNATLWYKIFTTARDSNTKYAQDYNPFWCYKGAIGKVYHALNPKLTVIVPDDDRSLI
NLHLMHTSYFLFVMVITMFCYAVIKGRPSKLRQSNTEFCSEKVSV
Download sequence
Identical sequences H0Z4P7
ENSTGUP00000005542 59729.ENSTGUP00000005542 ENSTGUP00000005542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]