SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005552 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005552
Domain Number 1 Region: 6-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.28e-22
Family Ubiquitin-related 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005552   Gene: ENSTGUG00000005389   Transcript: ENSTGUT00000005607
Sequence length 406
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:66304102:66323377:-1 gene:ENSTGUG00000005389 transcript:ENSTGUT00000005607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSVVEHPVTLIIKAPNQKYTDQTISCFLEWTVGKLKSHLSKVYPSKPSTKDQRLVYSG
RLLPDHLQLKDVLRKQDEYHMVHLVCTSRTPPSSPKPSTSREGHGMSTSSSSSNLDRSGS
TAASPTNQEVSSTSLNTSADGVRHRNLPQAHSNPMPSHQFPYLMQGNISNQFPGQGVPAG
FSMYPAFSPLQMIWWQQMYVRQYYMQYQAAVSAQVTSSTESARSAVAQAANSEHAPPNEP
AAVPNVAVQENRPVNQNVQMNAQGGPVVNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSF
SRFVMVMGAMLLVYLHQAGWFPFRQEGGQQQAANNAEVNRDGQHANNPDLEEMERLMDDG
IDEDNGEDASEDGNTEQQPGFMASAWSFITTFFTSLIPEGPPQVGN
Download sequence
Identical sequences H0Z4Q7
ENSTGUP00000005552 ENSTGUP00000005552 59729.ENSTGUP00000005552 XP_002199411.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]