SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005567 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005567
Domain Number 1 Region: 228-476
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.17e-84
Family Eukaryotic proteases 0.0000697
Further Details:      
 
Domain Number 2 Region: 131-232
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.088
Further Details:      
 
Domain Number 3 Region: 92-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005567   Gene: ENSTGUG00000005348   Transcript: ENSTGUT00000005623
Sequence length 476
Comment pep:novel chromosome:taeGut3.2.4:1:3311303:3329958:-1 gene:ENSTGUG00000005348 transcript:ENSTGUT00000005623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPPPPYYENRGFQPEPLYAARLAAGANPYPQLFTSPPSVPTYVPRVATHQSSRPAAPPPR
RSCAASVRKTIIIILSILIVICCAIAAFFIWYFVENHCLSSLIECGSSGVCMPPSQWCDG
ISDCPNGEDETRCVRLFGPNFILEVYSPVSKSWYPVCQDDWNDDYGKIACKDMGYSMDTY
FYSRGVAPEVSFKSYMKLNTSAGNIDLYKKLYTSGSCASGKVVSLRCIECGLSSKSVSIM
NRIVGGSGAVLGQWPWQVSLHVQGTHVCGGSIITPHWLVTAAHCVEGRLSDPHSWRVYAG
ILNQDEMLFRSGYKVQQIISHPDYDTDSKDNDVALMKLETPLSFTETVRPVCLPNPGMMF
QPNQQCWISGWGAEHQGGKTSNSLNYVAVPLIEHSRCNAVYIYNGMILPTMICAGDLAGG
IDSCQGDSGGPLVTLHHSVWWLVGDTSWGTGCATPNKPGVYGNMTVFTDWIYKNMQ
Download sequence
Identical sequences H0Z4S2
59729.ENSTGUP00000005567 ENSTGUP00000005567 ENSTGUP00000005567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]