SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005577 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005577
Domain Number 1 Region: 53-213,300-464,492-608
Classification Level Classification E-value
Superfamily Ras GEF 8.11e-116
Family Ras GEF 0.00021
Further Details:      
 
Domain Number 2 Region: 725-819
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-40
Family Ras-binding domain, RBD 0.00000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005577   Gene: ENSTGUG00000005351   Transcript: ENSTGUT00000005634
Sequence length 850
Comment pep:novel chromosome:taeGut3.2.4:17:7587348:7608408:-1 gene:ENSTGUG00000005351 transcript:ENSTGUT00000005634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFDPDLPPLESSTQEIGEELEDGVIYSISLRKVQLHHTANGQRWLGFENESALNLYETCK
VRTIKAGTLEKLVEYLVSAFKGNDSTYVTIFLCTYRAFATTKQVLDLLLNSAGCSLPPLC
PTRYGKLHVQANGDHARHTLKNTISSILGAWLDQYSEDFRKPPDFACLKQLISYVRHNIP
GSDLERRARILLAQFQQQEQSEAEAEGGLLPWLVGSFGAAGGGNAAGWHRGSPKLEPPNP
AAAGTLAPRFKMTVLLSEPYGKGEAGRWGVGVCRGLVWALQCSASPLSPAAVDHGSCTFQ
LVEENGVGDGKPDFLSFSPEMVAEQFTLMDAELFKKVVPYHCLGCIWSQRDKKGKEHLAP
TIRATVSQFNSVANCVIATCLGDRSLKPQQRAKVVERWIEVARECRILKNFSSLRAILSA
LQCNAVHRLKKTWDEVLRESFRTFHELSEIFSDENNHSLSRELLIKEGTSKFATLEINPK
RAQKRQQQQREMGVMQGTIPYLGTFLTDLVMLDTAMKDFLDGGLINFEKRRKEFEVIAQI
KLLQSACNNYSFTQEDQFVEWFHSLERLSEAESYGLSCEIEPLSESASNTLKAKKNTGII
KRWSDRQPPSTEPCASGSSHSKSFDQLKCGQYLCSGDATDSVSVTSAGSSSSDVEEINIS
FIPESPDCQEKKFWESTSLSSLDTSGIGSGSSSASSSSVSSTPVTASRTHKRSVSGISSY
SSLSLPLYNQQVDDCCIIRVSLAVDNGNMYKSILVTSQDKTPVVIRKAMAKHNLDGDRPE
DYELVQIISEERELKIPDNANVFYAMNSAANYDFVLKKRGFSKGVKIKHGSSSTLPRMKQ
KGLKIAKGIF
Download sequence
Identical sequences H0Z4T2
59729.ENSTGUP00000005577 ENSTGUP00000005577 ENSTGUP00000005577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]