SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005592 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005592
Domain Number 1 Region: 620-912
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.59e-75
Family Protein kinases, catalytic subunit 0.000000267
Further Details:      
 
Domain Number 2 Region: 4-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000285
Family MAM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005592   Gene: ENSTGUG00000005416   Transcript: ENSTGUT00000005649
Sequence length 1132
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:20970321:21036491:1 gene:ENSTGUG00000005416 transcript:ENSTGUT00000005649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLPSGFYCSFEEGDCGWMPGSSASHPSPWRIGSAEHKRFPSIEGCALLLNTSKAPAVAKT
VMTSTAFPAPLRNSPFCDLRMSWLIQGVLLGNVSLVLVENKTGKEQSWTFWHSENSKGLG
IWQWMILPLPEILDRFWFQITASWEEGSDAIIAFDNVSLSLDCYLTSLCQKSLCLGREPH
SARLMQKPVSATSVALFELNTSKPLLQSEYQWLFTTCGASGPYGPTQSQCNDAYRNSKLR
VVVGAEGILQGIQIWRVPATNTYSISGYGAAGGKGGKNTMVRSHGVSVLGIFDLQKDDTL
YILVGQQGEDACPSTNDVIQKVCIGENNVIEEEIRVNRSVNEWAGGGGGGGGATYIFKME
NGEPIPLIIAAGGGGRAYRAKTDTFHPERLENDSSIPGLNGNSGAAGGGGGWNDNTSFLW
SGKSLLEGATGGRSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAAVDNDPEMD
GEDGVSFINPIGTLYTPALKGIHTGAQSSITRFASYSCAAVRAGHPRVKSMVILFFCLDY
MHLGDDILQSSSCFCSEPVVRLPFSLVLSVVTSALVAALILAFSGIMIVYRRKHQELQAM
QMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTTSISDLKEVPRKNISLIRGLGHGAFGE
VYEGQVTGIPSDPTPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQA
LPRFILLELMAGGDLKSFLRETRPRPNQPSSLSMLDLLHVARDIACGCQYLEENHFIHRD
IAARNCLLTCRGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSK
TDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQCWQHQ
PEDRPNFAIILERIEYCTQDPDVINTALPVEYGPSAEEEEKVAMRPDDPEGIPPLLVSTH
QDRKDEKQTLPSPPPLPSAVTAGKSLGKVGALEQPAPGKVSSATAGGHINMAYAQSNPPS
ELHKSRGSRNKPTNLWNPTYGSWFAEKQASKNSSLLEKERSERENLGQEGNCTVGPNIVT
GRLPGSSLLLEPSSLTASVKEVPLFRLRHFPCGNVNYGYQQQGLPLENSTPP
Download sequence
Identical sequences H0Z4U7
59729.ENSTGUP00000005592 ENSTGUP00000005592 ENSTGUP00000005592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]