SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005606 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005606
Domain Number 1 Region: 416-675
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-53
Family YWTD domain 0.0000000839
Further Details:      
 
Domain Number 2 Region: 208-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000406
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 3 Region: 5-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000115
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 4 Region: 121-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 5 Region: 245-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 6 Region: 329-407,676-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000102
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 7 Region: 161-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 8 Region: 43-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 9 Region: 80-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.00025
Further Details:      
 
Domain Number 10 Region: 290-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005606   Gene: ENSTGUG00000005386   Transcript: ENSTGUT00000005664
Sequence length 847
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:64739986:64750339:-1 gene:ENSTGUG00000005386 transcript:ENSTGUT00000005664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GARAKCEESQFACGNGRCIPQIWKCDGDEDCLDGSDESACVKKTCAESDFVCLSGQCVPN
RWQCDGDPDCEDGSDESSELCHTRTCRVNEISCGPQSTQCIPVSWKCDGEKDCDSEEDEQ
NCGNVTCSPADFTCSSGQCISKSFVCNGQDDCSDGSDELECAPPTCGVHEFQCKTSTCIP
LSWVCDDDADCSDHSDESLEQCGRQPAPSVKCSASEVQCGSGECIHKKWRCDGDPDCKDG
SDEINCPSRTCRPDQFRCEDGNCIHGSRQCNGVRDCLDGTDEANCNNVIQCSGPGKFKCR
SGECIDINKVCNQQRDCKDWSDEPLKECNINECLLNNGGCSHICRDLVIGYECDCPAGFE
LLDRRTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTN
RRDIRKIGLERKEYIQLVEQLRNSIALDADIAEQKLYWADFSQKAIFSASIDTRDKVGTH
IRILDNIHSPAGIAVDWVYKNIYWSDSTAKTISVASLDGTKRKVLFLSELREPASIAVDP
LSGFMYWSDWGEPAKIEKAGMNGFDRQQLVTTEIQWPNGIALDLVKSRLYWLDSKLHMLS
SVDLNGQDRRIVLKSHMFLPHPLALTIFEDRVYWIDGENEAVYGANKFTGNDLVTLVNNL
NDAQDIIVYHELVQPSGRNWCEEHMANGGCSYLCLPAPQINEHSPKYTCACPAGYFLQED
GLRCTGTGTTVAYTEAKDTSTTEKSPTVGPVPGGFNTSGTTSEVTAAGRTSAAWIILPAV
LLMMAAAAGYFMWRNWQHKNMKSMNFDNPVYLKTTEEDLTIDIGRHSGSVGHTYPAISVV
STDDDMA
Download sequence
Identical sequences H0Z4W1
59729.ENSTGUP00000005606 ENSTGUP00000005606 ENSTGUP00000005606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]