SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005616 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000005616
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.000181
Family TAP-C domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005616   Gene: ENSTGUG00000005449   Transcript: ENSTGUT00000005674
Sequence length 646
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:5159089:5199550:1 gene:ENSTGUG00000005449 transcript:ENSTGUT00000005674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALNDYEQLRQVHTANLPQVFNEGR
FYKQQEPEQPPQVTKAERPCLQRQDDIAQEKRLSRGISHASSAIVSLARSHVANDCSNEQ
FPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLP
LATTGDGNCLLHAASLGMWGFHDRDLVLRKALYTMMRSGAEREALKRRWRWQQTQQNKES
GLVYTEEEWEREWNELLKLASSEPRTHFSKNGGTGGGVDNAEDPVYESLEEFHVFVLAHI
LRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVLPNRCHCSPLVLAYDQAHFSALVSM
EQKDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNTRLANLILSLEAKLNLL
HSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSMDSDRDSICSNSNGNNGKNGK
EKEKDKQRKDKDKTRTDSVANKIGSLSKTLGIKLKKNMGGLGGLVHGKMSRANSGNGKNG
DTVEKVKEKKSKSRKGSKEESGHSSPTEKVNTKPFSDKQSDPWKYSTDVKLSLNILRAAM
QGERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFNAEQEQKRKE
Download sequence
Identical sequences H0Z4X1
ENSTGUP00000005616 ENSTGUP00000005616 59729.ENSTGUP00000005616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]