SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005636 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005636
Domain Number 1 Region: 294-550
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.42e-82
Family Eukaryotic proteases 0.000000069
Further Details:      
 
Domain Number 2 Region: 100-207
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-32
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 3 Region: 210-295
Classification Level Classification E-value
Superfamily Kringle-like 1.38e-28
Family Kringle modules 0.0000671
Further Details:      
 
Domain Number 4 Region: 34-78
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000146
Family Fibronectin type I module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005636   Gene: ENSTGUG00000005459   Transcript: ENSTGUT00000005694
Sequence length 551
Comment pep:known_by_projection chromosome:taeGut3.2.4:22:3332620:3340893:-1 gene:ENSTGUG00000005459 transcript:ENSTGUT00000005694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKLPCLLLLVGAIMTSQCQGLHMRFKRGARSRAVCTDNSSTEIYQHRGTWLRLSGSRI
EYCRCNSGRSRCHTVPVRVCTRNKCYNGGQCSQAYYSPQLFICQCHQGFSGKQCEIDTEV
KCYKDAGVTYRGTWSMTESGTECLNWNSDGLVNWMYSGQREDAAELGLGNHNYCRNPDED
SRPWCYVYKGGRYTWEHCSVPSCSKVRNINCRSGRGTDYRGSHSVTSSGATCLKWNSRIL
VNKLYTAWRRDAYQIGLGSHNFCRNPDNDSKPWCHVLKGNQLTWEYCNVPTCSTCGLRQR
RVRRYRIKGGSYTDIAAHPWQAAIFVKYHRVPGEHFLCGGILISSCWVLSAAHCFEEGFS
TNQLKIVLGRTSRATPEENEQKFQVKNYTVHQRFDSENFNNDIALLQLNSDAEDCAVETG
TVRTACLPTPELQLPDWTECEISGYGRNEEFSPFYSENKEGHVKLFPASRCTAQYLDNRT
VTDNMLCAGDTRNLDDACKGDSGGPLVCMKDDRMYLIGIISWGIGCGRKDIPGVYTNVTR
YLDWIQDTMKL
Download sequence
Identical sequences H0Z4Z1
ENSTGUP00000005636 59729.ENSTGUP00000005636 ENSTGUP00000005636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]