SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005691 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005691
Domain Number 1 Region: 87-132
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000144
Family Elafin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 374-453
Classification Level Classification E-value
Superfamily SEA domain 0.0000876
Family SEA domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005691
Domain Number - Region: 479-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000107
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 291-358
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000465
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number - Region: 238-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0457
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005691   Gene: ENSTGUG00000005528   Transcript: ENSTGUT00000005749
Sequence length 1217
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:3658314:3709382:1 gene:ENSTGUG00000005528 transcript:ENSTGUT00000005749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGLSLLGYHLCNYTLTRSVFKMVAYQKSYEKNTSCGGWIPWMVCPQTRYRTEFHTVEVP
ETITLTDCCEGYEQVGLYCSLALNRSSVFASRPGICPVKDMETFDYPCTFDTQCPGLKKC
CSSSKGAGCVDPMPEGMPWLAPTMFWYNVTVLVKMDFNELTRVDFHFLNHSRLLHSMVTG
ALQPLNASVHHIQSNPGDIYAGTVTSQLLLGMQHPAPLAEVSSSLKAMVKRVYEVIDTQV
QDVNECSYAEFNACPEKSSCVNLEGYYSCHPQPEHATGIPPWLSPRKEECPAVFTDHRIL
SVTSNSFEMSWLVSSPLNHSFQVRVAKGNETVQNLKTEEMQMDVSHLEAGVMYSVEISYE
TCGKTMISRQNVKTEAKIFAVTMRILNYNFTDDFHNSSSSAYEEFSRLLLTELENSFPPD
ISALYKSGKLRVQIESLAAGSIIVRLRITVQDPEFPVDVSTFAPVLSSLHNGSVLVVDQQ
NTAVKDWDECASQAENDCSVLAECINLMGSYMCRCKTTMDSNPSRPGRNCEGEKKAGIGL
LQAGISPLPYKALPDYYFFSSRTYPSPNDYFPNVSRTWSQSWNLMPDTLWRCSQVCARRK
TDVCSGTFSLKVQPNHTWWGNFSSLSEKTVLKQYSVQITVPFIYLFPVSRLSVYSLLRFP
LCATEIADTVTDLKIISLVQTPHTQGIVLITQGVVPVGLKMLQSKRSIVCCFPPEQEAQH
SFLSSVQKSLPLEVLQQMDAGLIKVLVTGVTNGSTVVNFNLLLAEEVDVHHVITTFCEAL
EHSSYFTINRSSLSTHAVKHTDKKPTDKKPVNSTILPVTSLQTSAHVSSPASLDFSPAEH
KALEDTTFSSTVLTPLTTDPMATPDVPPRASPAPLVKPTQEVSIKDAVSVLCEIERIVLA
IQKRFLLQESIPESSLFLGEPGCNVSTSNGTHVVLQAGWSDCGTQVETNMTTTVVRTTLR
NDVSAQGIIHHLNVASPIHCVFQNNVLTSSGYTAEGLYTIFEDLHGSGYFRTEMQLFIGN
SPVPKNFSVSASEDVLIEVGMQRADSQLKVVLTDCWATPTNNSMDPLSFVFISNSCPIPN
TYTTLLENGNSSKAQFKMKIFSFVNNSVVYLHCRIRICMESPGSTCRTRCHARARLLKAG
DTIALHRTSWGPLCKSAGDPREKEAGMGIGYIILIALAVFGFVLGVVTLLIFQYQRKTGR
YNLRIKSDNFSYQVFYD
Download sequence
Identical sequences H0Z545
ENSTGUP00000005691 59729.ENSTGUP00000005691 ENSTGUP00000005691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]