SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005716 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005716
Domain Number 1 Region: 1-203
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-43
Family Reprolysin-like 0.0023
Further Details:      
 
Domain Number 2 Region: 297-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000196
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 977-1041
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 712-776
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000034
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 5 Region: 921-983
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000111
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number 6 Region: 598-657
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000129
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 7 Region: 1198-1288
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000478
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005716
Domain Number - Region: 1093-1188
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000299
Family Spermadhesin, CUB domain 0.0074
Further Details:      
 
Domain Number - Region: 806-864
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000641
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005716   Gene: ENSTGUG00000005547   Transcript: ENSTGUT00000005774
Sequence length 1288
Comment pep:novel chromosome:taeGut3.2.4:17:7714601:7729961:1 gene:ENSTGUG00000005547 transcript:ENSTGUT00000005774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLELMVVAGPDVYLYHREDTERYILANLNIGAELLRDASLGAHFRVHLMQMLVLREPEAE
VNITTNITSSLISVCEWSKKVNPQNDSDPQHADIVLYITRFDLELPDGNKELRGVTQLGG
VCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIAHDGEGNVCSSSGYIMGSAGNHNSIDLT
WSPCSREQFLALVSTGQTSCLNDLPDMDGSIPGWKPGLYYGADEQCKIAFGSVATACTFA
DTNVDICKVLSCHVQPADKSSCTRLLVPLLDGTECGINKWCSKGQCSSLEELNPMAVVHG
HWSAWSPLSPCSRSCGGGVVLRQRFCNNPRPAFGGQECHGASMQAEMCNTQACLMTQQDF
MAEQCAATNLKPLYLDVETPSFYTWTSAVGFAKGDLLCKHMCRAVGKEFMVSRGDNFLDG
TRCEQDDTEHHGDLHLCVMGSCRAFGCDGQMGSRKAMDACKVCGGENSTCTEVSGSYTEG
KAKEYVTFLSLPYNTTSAHVTNRRPLFTHLAVKVKGEYVVAGKGKISLNVTYPSVLEDNQ
IKYQVFLTQDNLPSLEEIHVDGPTQEEVEIQVYRRYTKEYGNATNPDITFSYFVPRESLT
YLWIPQQGPCSVTCGEGVQPVAHVCFDQTKNEVTEDQWCLELPQPLPEHKPCAMGPCLYR
LVLLGAQLNSCFALPLNPGSLCICVVQGQKKKYKRRCLSHPFQDGANKEVFNKNCLPFRW
KMSQRDECSAVCGTGVAQQNLTCVQFHDGLETVVDDSLCPAEEKPLSLVPCVVNVCPLGW
DKVRTSLGALHFCPPSLGHVQLENQTVYVWSPVAGECSVSCGRGKTQLHYVCVAFDTKEE
TQEENCQPVPKPESRVEVCDLNPCPPSLRIVVSLPCPLCCGTGKLLQLFLQDATPRAAPA
CIPNTIDHRQGGDSSLTHFSPPCPARWKVTPAGPCSSSCGLGLAAQLVTCVQTLHGQEVL
QEEHLCPVAEKPLTSVPCVIRTCSYEWSFSEWSECSTTCGNGIQTRQDFCLSSLTHKPVN
PLFCRRFPKAIVVRGCSAGPCPEQEGTQAPGAELQPVPPATHLPTAAPEHRHKDLDVPLS
AGPWEQTEPSGGVCGNLFLNATGIINMTGVGSRDCTVAIGRPLREEISVTILESSLNCSA
GEVLLFSGRMMWRTGCRKLPLSLINSRTNTLIVKQRVVLPGNGVILQYNSRTATKKYYQD
CDQQLFGPQGEIVAPVERQEGVCRTFITVAPRQRISIRALNTDLGPEGNQTDFNYILVRD
VSTMKTVVFRGKQQFLWQSTGSQAEIEF
Download sequence
Identical sequences H0Z570
ENSTGUP00000005716 59729.ENSTGUP00000005716 ENSTGUP00000005716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]