SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005768 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005768
Domain Number 1 Region: 206-452
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-88
Family Eukaryotic proteases 0.0000913
Further Details:      
 
Domain Number 2 Region: 109-215
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-16
Family Hepsin, N-terminal domain 0.078
Further Details:      
 
Domain Number 3 Region: 75-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005768   Gene: ENSTGUG00000005582   Transcript: ENSTGUT00000005826
Sequence length 454
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:3888738:3907127:-1 gene:ENSTGUG00000005582 transcript:ENSTGUT00000005826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIISVTEDEPPVPQIQFTFKRFFIPQARVDPSADGSGDIEPPSMCHALVSLKYFPYVCGL
FLAVTLAVAIGLGVQYNCIGKFRCRSSFKCIQKSARCNGVFNCKEGEDEYRCVRLSGKRA
VLQVFTFGSWRTVCSDDWRAEYGNTTCKHLGFSSYVSSGDLPVAAVEKQFQRHFVSLGHW
FSADQGTSLHNATNLREECSSGNVIILKCLACGTRASYGARIVGGNASSPRQWPWQVSLQ
FQGHHLCGGSVITPLWILTAAHCVYDLYLPSSWSVQVGFVTQQDTQVHPHSVEKIIYHRN
YKPKTMGNDIALMKLAAPLTLNGHIEPICLPNFGEHFPAGKMCWVSGWGATVEGGDTSDT
MNYAGVPLISNAICNHRDVYGGIITSSMLCAGFLKGGVDTCQGDSGGPLACEDMSVWKLV
GTTSFGVGCAEKNKPGVYSRTTSFLDWIHEQMEV
Download sequence
Identical sequences H0Z5C2
59729.ENSTGUP00000005768 ENSTGUP00000005768 ENSTGUP00000005768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]