SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005853 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005853
Domain Number 1 Region: 411-519
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 2 Region: 10-111
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-21
Family PDZ domain 0.0000872
Further Details:      
 
Domain Number 3 Region: 172-274
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.025
Further Details:      
 
Domain Number 4 Region: 692-802
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000001
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 5 Region: 520-596
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000617
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005853   Gene: ENSTGUG00000005653   Transcript: ENSTGUT00000005912
Sequence length 1782
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:5669952:5736694:-1 gene:ENSTGUG00000005653 transcript:ENSTGUT00000005912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARAAAASTKSTTMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISD
VLKGGPAEGLLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRMKKIQIPVTR
PDPEPVSENEDDSYDEEIRDPRSSRGGPSASRRHEKSWVRDRSASRERSLSPRSDRRSIT
SSQPSKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVT
ENMSLADAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLAS
DHSNRSHDRPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSHRSREDERITKPGAVSTPVKN
TDDISKAVEEVTVERTEKQTPPLPEPKPVYAQGGQPDVDLPVSPSDGPLPNSTHEDGMLR
PSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNII
REEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNK
GEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRA
DFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVARE
KLAREEPDIFQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDRDKHALLDVTPNAVDRLNYA
QWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERAHKLRKNNHHLFTTTINLNSMN
EGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRH
TSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHETQSYPAYA
SQAQPQPNLRIDSSGFKATTTQPKAEASPAVPYLSPSPESNPATSSASAVNANVNLTNIR
LEEPTAAPYNSYQPQAAPLRTPCTEGAHVVLRDQEPSSLPPHIDPAKVYRKDPYVNEEAS
RQSYVLKQPAINHPVQRQERDPNLIYESQAQYAEKQPSRDYEQSTYRYDSTNYVDQFSRG
YDPRLHYDDRVPPYEEHWTYYEEKQPYNQTRTAYENQPPRDLDSRQNLEESTERSYYPAQ
PRFEEPPAMSYDSRPRYEHAPKNFSLPQVRYEDQHTAGYDAHGRYKAEAQPYQSAISRSP
EPKQYFDPHIRGYEQGPPQAYNAKAGQYEPSHSTSGVSLPPPPSSQTKPEVLPSNSKPLP
TPPSLAEEEEDPAMKPQSVRSRVKIFERRRSPSLEKMKDTSDTSTVKPPELAPKPVLTSV
SGPKQASQSQYEHEKTTYRAPEPQRPQVKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRS
FENKPSAQVPASHHSEPTKPIHSQNQLNFSNYSKGKPTDTEPMDRPVGEKRYEPIPPVTT
PPPAPSVQYTQPQSINSPVLSLPAHHKPALSEGEHSSIFIFIAVNSVSDPPPPQNKSSIF
RSSREDTVQSTFYPQKSFPDKGPVNGTEQIQKTVTPSYNRFSTKPYTSAARPFERKFESP
KFNHNLLPNEAQHKPELPSKSSNSPQPILKAHSSSQPPDFESGMDTHAVQVDKPKYQPNN
VNAVPKAIPVSPTALEDEEEEDGHTVVATARGVFNSNGGVLSSIETGVSIIIPQGAIPEG
IEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGW
SFALKSSDSSSGDPKTWQNKSLPGDPNYLVGANCVSVLIDHF
Download sequence
Identical sequences H0Z5K7
ENSTGUP00000005853 ENSTGUP00000005853 59729.ENSTGUP00000005853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]