SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005920 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005920
Domain Number 1 Region: 215-381,679-897,952-997
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-113
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 362-448
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-17
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 3 Region: 93-218
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000484
Family cAMP-binding domain 0.00083
Further Details:      
 
Domain Number 4 Region: 589-668
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000672
Family Ras-binding domain, RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005920   Gene: ENSTGUG00000005715   Transcript: ENSTGUT00000005979
Sequence length 1469
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:30007643:30049672:1 gene:ENSTGUG00000005715 transcript:ENSTGUT00000005979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLPE
TAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMT
MSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGRTEILCMGNSFG
VSPTMEKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHREL
DRTGTRKGHIVIKGTAERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEWF
NDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLNIACAAK
AKRRLITLTKPSREAPLPFILLGGSEKGFGIFVDSVDFGSKATEAGLKRGDQILEVNGQN
FENIQLTKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDIKKASRY
SIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQD
DSIVGLRQTKHIPPALPVSGTLSSSNPDLLQSHHRILDFNTTPDLPDQVLRVFKADQQSR
YIMISKDTTAKEVVIQAIREFALTATPDAYSLCEVSVTPEGVIKQRRLPDQLSKLADRIQ
LSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPTE
YIDDLFKLKSKTGCTNLKRFEEVINQETFWVASEILRETNQLKRMKIIKHFIKIALHCRE
CKNFNSMFAIISGLNLAPVARLRTTWEKLPSKYEKLFQDLQDLFDPSRNMAKYRNVLNSQ
NLQPPIIPLFPVIKKDLTFLHEGNDSKVEGLVNFEKLRMIAKEIRHVGRMASVNMDPALM
FRTRKKKWRSLGSLSQGSANAAVLDVAQAGGHKKRVRRSSFLNAKKLYEDAQMARKVKQY
LSNLDLEMDEESLQTLSLQCEPATNTLPKNTGDKRSGKSETSPVAPRAGIQQKVQQQHKV
NQALQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLDRHKKQSEDTVSSA
SSQLSSPPTSPQSSPRKGYTLAPSSTVDNFSDSGHSEISSRSSIVSNSSFDSMPVPLHDE
RRQRHSVSIVETNLGVGRIDRRIMIEPDQYSLGSYAPLSETRGLYAGATVLSSPSTEELS
QDQGDRASLDAADSGRGSWTSCSSGSHDNIQTIQHQRSWETLPFGHAHFDSSGDGAGLWA
SGGHMDQLMFPDHGTKYGRQSQGREGLDQAQSRASWASSTGYWGEDSEGDTGTIKRRGGK
DVSIEADTSSITSVPAEETKPAPVPPHTAAASSSTKGLVARKEGRYREPPPTPPGYVGIP
IAEFAEGGSHPARKPPDYNIALQRSRMVARTCETHGTATPQQQSHGHSTGRPVNKPQWHK
PNESDPRLAHYPSQGFSTEEDDTEQITQI
Download sequence
Identical sequences H0Z5S4
ENSTGUP00000005920 59729.ENSTGUP00000005920 ENSTGUP00000005920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]