SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005954 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005954
Domain Number 1 Region: 279-376
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 439-726
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 3.66e-18
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.033
Further Details:      
 
Domain Number 3 Region: 200-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000931
Family I set domains 0.066
Further Details:      
 
Domain Number 4 Region: 27-78
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000887
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 5 Region: 109-194
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000102
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005954   Gene: ENSTGUG00000005764   Transcript: ENSTGUT00000006013
Sequence length 788
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:30634891:30818807:-1 gene:ENSTGUG00000005764 transcript:ENSTGUT00000006013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGQDGHFGSCENKYCGLGRHCVVNGKTGQAECLCMEHCKPHYKPVCGSDGEFYENHCEVH
RAACLKKQKITIVHSEDCFFKGDKCKPTEYTDVKNMLLDLQNQRYITQSKDKSVGDKMAL
TKLLIDQMFKYFDSDNNGLVDTNELSQVIKRDELGKERSDCSVFDLLKYDDYNSDKHLDL
EEFYRAFHVVQLNLPEDQKISTTAATVGQSAVLSCGIQGTLRPPIIWKRNNVILNSLDLE
DISDFGDDGSLYITKVTTTHMGNYTCYADGYDKLYQTHILQVTVPPVIRVYPESQAREPG
VTASLRCHAEGIPNPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCVA
KNEAGVDEDISSLFVEDSARKTLANILWREQGLGIGNMFYVFYEDGIKVIQPVECEFQRH
IKPSEKLLGFQASFCPKADSDPVQRCVWATAVNVKDKFIYVTQPTLDRVLIVDVQSQKVV
QAVSTDPVPVKLHYDKSHDQVWVLSWGNMEKNLPTLQVITQASGSVSHHTIHTQPFDRVD
DFFIPATTLIITHVRFGYILHRDDPLLQKIDLETMSYIKTISLKDYNCIPESLAFTHLGG
YLFICCKPDTTGAVLPQLIVDSVTDSVVGYNGDVTGTPHVSPDGHYLLSIDDAKGLLRIQ
SITVRGEIQDAFDIHTNLHISDVAFQPSFTEAHQYNVYCSSSTQTDVLFLELSSGKVKMV
KSLKEPMKAGEWPWNSKNRLIKDSGLFGQYLMTPSKESLFILDGRLNKLNCEITEVERGN
TVVWVGEA
Download sequence
Identical sequences H0Z5V8
ENSTGUP00000005954 59729.ENSTGUP00000005954 ENSTGUP00000005954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]