SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006013 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006013
Domain Number 1 Region: 16-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000647
Family Ubiquitin-related 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006013   Gene: ENSTGUG00000005827   Transcript: ENSTGUT00000006072
Sequence length 308
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:10100878:10113707:-1 gene:ENSTGUG00000005827 transcript:ENSTGUT00000006072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVSSQVEILDWETKKQLCFLDKVEPNATIREIRLMFHKLYPRWYPARQSIKLDPKGKSLR
DEEILQHLPVGTTATLYFKDLGPQIRWTTVFLIEYTGPLFIYFVFYFRMTFVYGLDERFT
SSPHPVVNLACICHSFHYIKRLIETVFVHRFSRGTMPLRNIVKNCLYYWGFAAWLAYYIN
HPLYTPPSYGKKQINFAVIMFLLCEAGNFSIHVALSDLWRNGSKTCKIPYPTKNPFTWLF
FFVSCPNYTYEVGTWISFTIMTQCVPVGLFTLLCFIQMTVWAKDKHCTYLREFKDYPSHR
MPIIPFLL
Download sequence
Identical sequences H0Z615
ENSTGUP00000006013 ENSTGUP00000006013 59729.ENSTGUP00000006013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]