SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006052 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006052
Domain Number 1 Region: 110-241
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.35e-43
Family UAS domain 0.000000207
Further Details:      
 
Domain Number 2 Region: 336-354,385-467
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-25
Family UBX domain 0.0000129
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006052
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily UBA-like 0.0115
Family TAP-C domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006052   Gene: ENSTGUG00000005882   Transcript: ENSTGUT00000006111
Sequence length 468
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:4316180:4334800:1 gene:ENSTGUG00000005882 transcript:ENSTGUT00000006111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIAGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPSTSSAAVSAARPHPEDEVRAPI
PQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAVDKKLTTLADL
FRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIRDHF
IFWQVYHDSEEGQRYIQFYKLADFPYVSILDPRTGQKLVEWHQLDVTSFLDQVTGFLSEH
GQLDGHSSSPPQKCSRSESLIDASEDSQLEAAIRASLQETHFDSTQAKQESRSDEESESE
LFSGSEEFISVCGSEEEEESEIPAKLRKSPHKDLGYKKEESRRPQPEPTARTEPGTTSNH
RVLPCIDAGALEESPDKPESTFRGLDVNGPKAQLMLRYPDGKREQVSLPEQAKLLALVKH
VQSKGYPNERFELLTNFPRRKLSHLDYEITLQEAGLCPQETVFVQERN
Download sequence
Identical sequences H0Z654
59729.ENSTGUP00000006052 ENSTGUP00000006052 ENSTGUP00000006052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]