SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006072 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006072
Domain Number 1 Region: 23-284
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-94
Family Protein kinases, catalytic subunit 0.0000125
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006072
Domain Number - Region: 298-346
Classification Level Classification E-value
Superfamily UBA-like 0.0313
Family UBA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006072   Gene: ENSTGUG00000005884   Transcript: ENSTGUT00000006131
Sequence length 805
Comment pep:novel chromosome:taeGut3.2.4:1:4474760:4485040:-1 gene:ENSTGUG00000005884 transcript:ENSTGUT00000006131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIMSEFASAPAAAHGQQRPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKT
RLDPSNLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDHLTSNGHL
SESEARKKFWQILSAVEYCHSHHIVHRDLKTENLLLDANMNIKLADFGFGNFYKSGEPLS
TWCGSPPYAAPEVFEGKEYEGPHLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRF
RIPYFMSEVCLCHPNCETLIRRMLVVDPTKRITISQIKQHKWMQADPSLQQQQSLCFSMQ
NYNSNLGDYNEQVLGIMQTLGIDRQRTVESLQNSSYNHFAAIYYLLLERLKEYWSSQVST
RPAAGRQPRPRSSEIANAEMPQDSLTSETLRSSLLYQQPQSLIQPSLQAEMDCDISNPLQ
PVFFPVDTNFNGLFRNRSISPNSLLETTISEEVRQEKELEDEIKAFDHPICIPSNTSRRH
TLAEVTTHFYQHVPPCIVISSSASPTEGTSSDSCLTSSSNDSSVALSSCLAGQVMTGSPA
TARMTSPFLASQSDAPVLQAQGCMGGASLLPVSFQEGRRASDTSLTQGLKAFRQQLRKNA
RAKGFLGLNKIKGFARQVCQSSSSRAARSAMSPFQHTQPNTCMYSSSGSSREGRSLLEEV
LQQQRMLQFQHHQLLQTACPHSHTPAASSFPSSDGPGTCKASNSILLSELQRENSFELAF
AGSSQLLQPHFFGVSVSPVSSAAHLLDTQLYISGGGGVPPLAASFSQQQSFSTPSPSYDG
VTLQHGDCEMEDLTSSQLGKFVLVK
Download sequence
Identical sequences H0Z674
ENSTGUP00000006072 59729.ENSTGUP00000006072 ENSTGUP00000006072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]