SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006079 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006079
Domain Number 1 Region: 3-330
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.28e-85
Family Glycosyl hydrolases family 35 catalytic domain 0.00043
Further Details:      
 
Domain Number 2 Region: 447-582
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.16e-30
Family Beta-galactosidase LacA, domains 4 and 5 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006079   Gene: ENSTGUG00000005849   Transcript: ENSTGUT00000006138
Sequence length 583
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:10546219:10550999:-1 gene:ENSTGUG00000005849 transcript:ENSTGUT00000006138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSFQLDYEHNCFRKDGVPFRYISGSIHYARVPRPAWRDRLLKMYMSGLSTVQVYVPWNYH
ETLPGVYDFTGNRDVEAFLDLTAELGLLVILRPGPYICAEWEMAGCRWAGVDAAASPCPS
SVPPVYLAAVDSWLHVLLPKIKPRLYHQGGNIISVQVENEYGSYYACDSGYLRHLLGSFR
ALLGSEVLLFTTDSTRAEELRCGTLQGLYATVDFGPGSNVTEAFGAQRRVEPKGPLVNSE
YYTGWLDYWGEAHASTSAAWVARGLEDMLQMGASINYMFHGGTNFAYWSAHTTSYKPVTT
SYDYDAPLSEAGDPTEKLFAIRTVISKFQPLPVGPMPPATPKYAYGWVALRKYADLLDVL
DVLCPSGPIQSQFPLTFESLKQVHGFVVYHTQLPWDVPDPATLDAPPHSICDRGYVMLQK
EYQGTLERDGQTPLHITGRAGDTLDILVENMGRISFGANTSDFKGLLGNLSLNSRPLSNW
LIYPLAIDTAVQQGWPHAALPKSSSEGQVGPAFYTGTFETPGIAWDTFVKFPGWSKGLLW
INGFNLGRYWTCRGPQQTLFVPGSVLHAGRPNNITVLELEGAP
Download sequence
Identical sequences H0Z681
ENSTGUP00000006079 ENSTGUP00000006079 59729.ENSTGUP00000006079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]