SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006096 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006096
Domain Number 1 Region: 5-105,385-555
Classification Level Classification E-value
Superfamily Cysteine proteinases 1e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000411
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006096
Domain Number - Region: 104-155
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0453
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006096   Gene: ENSTGUG00000005922   Transcript: ENSTGUT00000006155
Sequence length 1133
Comment pep:known_by_projection chromosome:taeGut3.2.4:14:8724828:8737820:-1 gene:ENSTGUG00000005922 transcript:ENSTGUT00000006155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVSKNAMQYRGNAQHDAQEFLLWLLDRVHEDLNNVVNSGGMPPLKPPLEDDVLLEGPAFP
ISSTFVQELFQAQYRSSLTCPHCQKQSNTFDPFLCISLPIPLPHTRPLYVTVVYQGKCSH
CMRIGVAVPISGTVARLREAVSSETKIPTEQIVLTEMYYDGFHRSFCDTDDLDTIHESDC
IFAFETPEIFRPEGILSQRGIHVNNNLNNLKCGTEHSRTIAYSQGTVKSGKLEQSCPKLA
ANDKIVLLVCNRACTGQQSKRFGLPFVLHLEKTIAWDILQKEILEKMQYFLRPAACLQVC
PFSLRVVSVVGITYLLPQEERPLCHPTVERALKSCGQGGTAHVKLVVEWDKETKDYLFVN
TEEEYIPDSESVRQQRELHHQPQICTLSQCFQLYTKEEQLAPDDAWRCPHCKQLQQGSIT
LSLWTLPDVLIIHLKRFRQEGDRRMKLQNMVKFPLSGLDMTPHVVKRSQSSWSLPSHWSP
WRKPYGLGRDPEDYIYDLYAVCNHHGTMQGGHYTGKSYCKNSVDGQWYCFDDSEVQQLSE
SEVCKQTAYILFYQRRTAIPSWSANSSVAGSTSSSLCEHWVSRLPGSKQPSVASAASSRR
TSLASLSESVELTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVSENGVRPLWSL
SAKLQFRSNSPSRFSGDSPVHTSASTLEKIGEAADDKVSTSCFGSLRNLSSSYLEPCDSS
RREHRTARRAPLAVMEGAFREESVVRTSSSDLSDGYGKSSVQPDRNHPALDPFDNNNQIA
FVDQSDSVDSSPVKEAKASAGTGLAAEKVHDTPRKGHGSKGASEPDKSLRKGRTVLATQE
TKVSRSSPPLKSSQKASRSRSKTDSSRVSGRHGSPAPTQARKDHSTKPLEASVPSAAQKQ
KSGSSPSSTAAKKTPSGPLTKGSSSGKSRTCERSLSREGSKVSLGSDKTSVTSSSRTSSP
RISHSRSDSRPADSRHVRSSSMANLRSPNAAARSGLKRDSKSEEKGLSFFKSALRQKETR
RSADLGKTTMLSKKTGSVSSKSGSKNVLEDKPEKGGAPPASQTNANITTKEKLVSKDATS
NKHSLLSSRKSKSSQLDPGVQSPPSSGKQSADKPLKKLPSSMQVSVRPSLEPQ
Download sequence
Identical sequences H0Z698
ENSTGUP00000006096 59729.ENSTGUP00000006096 ENSTGUP00000006096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]