SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006118 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006118
Domain Number 1 Region: 2161-2254
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-34
Family Link domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1536-1691
Classification Level Classification E-value
Superfamily FAS1 domain 1.2e-28
Family FAS1 domain 0.0011
Further Details:      
 
Domain Number 3 Region: 937-1094
Classification Level Classification E-value
Superfamily FAS1 domain 4.05e-26
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 4 Region: 489-623
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-25
Family FAS1 domain 0.004
Further Details:      
 
Domain Number 5 Region: 1701-1848
Classification Level Classification E-value
Superfamily FAS1 domain 3.14e-25
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 6 Region: 2252-2412
Classification Level Classification E-value
Superfamily FAS1 domain 5.23e-19
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 7 Region: 361-475
Classification Level Classification E-value
Superfamily FAS1 domain 3.66e-16
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 8 Region: 1099-1230
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000000929
Family FAS1 domain 0.005
Further Details:      
 
Domain Number 9 Region: 1431-1488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000022
Family EGF-type module 0.055
Further Details:      
 
Domain Number 10 Region: 1480-1514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000167
Family Merozoite surface protein 1 (MSP-1) 0.055
Further Details:      
 
Domain Number 11 Region: 202-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000177
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006118
Domain Number - Region: 845-883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000437
Family EGF-like domain of nidogen-1 0.046
Further Details:      
 
Domain Number - Region: 2048-2084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 887-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 2093-2128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 1348-1474
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00243
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 1962-2089
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 169-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00429
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 248-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0223
Family EGF-type module 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006118   Gene: ENSTGUG00000005918   Transcript: ENSTGUT00000006177
Sequence length 2416
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:5885739:5931075:-1 gene:ENSTGUG00000005918 transcript:ENSTGUT00000006177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCNVKTMFTLNTACTSCAAVPKMLCPRGWLRTTQRPGVRDCRYSVKLGENALSLPGCHH
MCKKEIEEKRCCPGFWGTECYECPGGSENPCNGHGTCLDGIQQNGTCICKEQYSGYACQN
CRDENRFGPDCQSECDCVHGECNSGVAGKGSCTCYGGYTGPRCDQELPLCKGVTCEANSE
CVVRDGTALCDCKLGYRKQGSTCQAQDPCAPSPCSPFAVCKVLGSRTYECTCKEGFQGDG
KICQPINPCVDSNGGCPENSTICVYRGPGEATCVCKSGMTGTGLPSVDTVMLFYLAISEG
IANWFTMVCYVSSLLHSCVCKEGEIGDGRSCYKDLLGEINQHNLRGRFIRKLNVAKKMFA
SGCSTLLTKYGPFTVFVPSLLPILDRMEFNSLFVFNDTTAEQLCRMHVVPGLHLIEDMIK
AKTMWTLSGHQLTFTSQDQNIIQIQVGWGAWELYNILQSNLPAANGIIHIVNSLRKKTST
DNLRNPQTILASMEIFSRFETILENCGLPAILDGPGPFTVFVPSNDGVDRLRDGRLIYLF
TEGINKLQELVKHHIYTSAAVTVEQLIMMPHIVTMANQILTINISADGRILMDESGIPLK
MRDIVASNGIIHALDGIFIPPSIVPILPHRCNEEQHKIVMGSCVDCEALNNSICPPGSKE
MVNIYLSCPHAGFASSFRKGCARYCNQTITKPGCCKGFFGPDCMPCPGGFSSPCYGRGNC
SDGIQGNGNCHCFEGFKGTACHICANPNKHGENCDEDCSCVHGVCDNRPGSGGVCQSWSC
KEGYTGKFCDKTSKNCGPSGLSQYCHQHAVCSLNDTARCICMDGYEGDGFSCQPIDLCSQ
PERGGCSQNALCTSTGPGTATCQCNVGWTGDGKACVPIDNCMLESRGSCHLNADCVYVGP
GQSKCVCKRGYAGDGHSCDAINPCLMDNGGCHDLATCVPLGGGERSCVCSEGYVGDGMTC
YGDILKELARNSHFVSFYNWVKKSLFSIPAGANVTVLVPSEAAIKNLSNADKDFWLTPYT
LPFLVRAHFLEGVFTAEKLKKYDRPELPTLNPQTRWQINTTSGVLTIQNASVVVSDIPAS
NGIIHILSKVLLPPPGEIPPSPPGLQEQLSTVASFSTFQDYIIAYQLIGKVESSEQYTVF
VPGNNSIEEYCRAANVTQLDKETVQYHIVLGEKLLPADLRSGVHKNSMLGLSYWLMFYQN
STQKFVNKIPLDGKSFETRNGILIGVSQVLQVQKNRCTANTTTILKSRCGKCDKGIKCPS
GSVLMGNQAAPMIRLYLVCVHRVALPSLFLLVFQRSVCCPGYYGHMCEMCPGRPGRWCSG
NGECQDGLQGSGECRCQEGFHGTACEMCEVGRYGADCKSECACDNGICNDGLRGDGSCEC
FPGWTGPTCQERIKIDLCNNTCHQMANCLNSSTDSQPTCFCSAGYTGNGTHCTEIDPCTI
DHGGCSMHAVCTKVSPGERTCACKEGYAGDGTLCMEIDLCLESNGGCHTNAECIKTGPKK
VACNCLPGYSGDGVSQCNPINLCEQNNGGCSPFGLCKYTGPGTRNCSCSWHSIGDGFTCR
GKVHQELGRIPDASTFFRMIQVESIKELSGAGPFTVFVPQTDFIGNTTVFEEWKSRGLLR
DLLRYHMVGCQKLLSSDLEGQESLTSLSGHKIKITVNENSITLNEEAKVVTSDIVGVNGV
IHFIDRILIPSDLVGRNISSKLSQNVTAVAEAFGYSVYSKLLQDAELLPLLGNPTHRPFT
LLWPTDAAFSALPENRQKFLYRREHRDVLASYLKAHIIRDTKIVAGNVPQVETIRTMHGS
TISFSCSKAHVVSGEILVGNGDATIIQRHMEFNGGIAYGIDRLLEPPDLGSRCDEFTLIE
LQVSTSLCLGTGSCRSWAEKYGVQWKPLLLVLKLNEQGCRRSCVSSQWVPQCCANHYGRD
CRACPGGLEAPCNNRGTCDDKIGGSGICNCSQEFIGTGCELCAPGRYGPECRECNCTENG
VCNGGLHGDGFCFCAEGWTGERCETRLVVTPTCSPPCHAQAACRAGNLCECDLHYEGDGR
TCSVIDMCSQDNGGCARHAQCSQSGVNVSCTCAPGYRGDGYICEPIDRCADGRNGDCSEH
ARCISTGPNERRCECKQGYVGDGIQCLEEVVPPTDRCLEDNGQCHREATCTDLHFHDKTM
GVFHLQSPRKKYDFTYEQAQAACAAEGASLATFQQLAAAQQMGFHLCLVGWLDNGTAGYP
TAYPNPSCGSSRVGIVDYGSRSNLSETWDAFCFREKDVTCTCSDGFVGDGYWCSGKLPDV
LADQDRFSTFYSMLLNFANDTEDGLDFFMYLSDVSAPKTLFAPLNSGFADNETLTGEELK
LHVSSSNVILFSFNLTTGTIIPSQSGYDLHVSELPANNSTKHSDAKGINDTMIVEWDIVA
FNGIIHVIAEPLRIPP
Download sequence
Identical sequences H0Z6C0
ENSTGUP00000006118 59729.ENSTGUP00000006118 ENSTGUP00000006118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]