SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006148 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006148
Domain Number 1 Region: 99-167
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000266
Family PHD domain 0.014
Further Details:      
 
Domain Number 2 Region: 192-270
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000221
Family PHD domain 0.01
Further Details:      
 
Domain Number 3 Region: 45-94
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000173
Family Tudor domain 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006148
Domain Number - Region: 572-593
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0874
Family Chromo domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006148   Gene: ENSTGUG00000005964   Transcript: ENSTGUT00000006208
Sequence length 596
Comment pep:known chromosome:taeGut3.2.4:8:10388285:10401650:-1 gene:ENSTGUG00000005964 transcript:ENSTGUT00000006208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDSAAVGNSLVHKRSPLRRSHKSSASLAKLSVHDGQKAKKPLCKFEEGQDVLARWSDGLF
YLGTIKKINKLKQNCFIIFEDSSKSWVLWKDIQTGKNFHESGEMVCTICQEEYSEAPNEM
VICDKCGQGYHQLCHTPNIDSSVIESDDKWLCRQCVFATTTKRGGALKKGPNAKALQVMK
QALPYNATDLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPML
FGDRFYTFICSVCSSGPEYLKRLPLRWVDIAHLCLYNLSVIHKKKYFDSELELMAYINEN
WDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNAAL
KADKEPEGTSHEFKIKGRKSSKPIPDVRELSNGIERKGKKKSVGRPPGPYTRKMIHKTPE
SSPLDNEPVPVIENPALELPCTVGKSDGTAHSSNTSDVESTGAASMKETTSSNISRHYSL
SDSRKRTRTGRTWPAAIPHLRRRGRFPRKALQTQNSEIVKDDESKEDYQYDELNTEILNN
LADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
Download sequence
Identical sequences H0Z6F0
ENSTGUP00000006148 ENSTGUP00000006148 59729.ENSTGUP00000006148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]