SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006159 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006159
Domain Number 1 Region: 36-241
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-39
Family Laminin G-like module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006159   Gene: ENSTGUG00000005847   Transcript: ENSTGUT00000006220
Sequence length 1832
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:8446371:8590231:1 gene:ENSTGUG00000005847 transcript:ENSTGUT00000006220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTHPRWKRHSWIRSQQCHSCCLLILLSPFLSAAEPADLLKVLDFHNLPDGITKTTGFCT
SRRSSKEADVAYRVTKDAQLSAPTKQLYPASPFPEDFSILTTVKAKKGGQSFLISIYNEQ
GIQQIGVELGRSPVFLYEDHTGKPGPEDYPLFRGINLADGKWHRVALSVQKKNVTLVLDC
KKKITKFLDRSEHPIIDVNGIIVFGTRILDEEVFEGDIQQLLIVADPRAALEYCEHYSPD
CDTAIPNSPQSQDPNQDEYYTDGEGEGDTYYYEYPYYEDVDEAVKPETPTTKPSPPEVAA
GEKPETKEDYPAPTAPPERGNPEKQPKEDRAVDDPLVDEYNYETINEEYFTPMPYEDLNY
NEEIDPQGGLTENAVEAELPTSTVVTYNETDAAQGGDELDKDFTEETIKEYDGNYYDNYY
DRTASPDIGPGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGLPGPPGPTGPVGLMGPPG
PTGPVGLMGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFSGGGDAGSKGPMVSAQEA
QAQAILQQARLALRGPAGPMGLTGRPGPMGPPGSGGLKGEAGEMGPQGPRGIQGPPGPAG
KPGRRGRAGSDGARGMPGQTGPKGKMGKKRGKNWEKKWGEVGEPGPHGPPGAPGEDGERG
DDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVAGMDGQTGPKGNVVSPPYKFSQAGKM
QNSGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGSQGPPGPQGPI
GYPGPRGVKGADGVRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGEDGPEGPK
GRSGPNGDPGPLGPAGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGTRGTPGKP
GPRGQRGPTGPRGERGPRGSTGKPGPKGNSGGDGPPGPPGERGPPGPQGPTGFPGPKGPP
GPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPGPPGPPGEQ
GLPGLTGKEGTKGDPGPAGLPRKDGPPGLRGFPGERGLPGPIGSPGLKGNEGPPGPPGPA
GSPGERGPAGSAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGIQGPVGLPGPA
GPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPAGADGEPGPRGQQ
GLFGQKGDEGPRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPSGPPGAD
GPQGPPGGIGNPGAVGEKGEPGESGEPGLPGEVGLPGPKGERGEKGEAGPSGAAGPPGPK
GPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPTGEPGPS
GPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLRGIPGPV
GEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEHGEKGDRGLP
GPQGSAGPKGEHTGLGSAPPVSPIPTGAGGPPGPKGAKGSSGPTGPKGESGLPGPPGPPG
PPGEVIQPLPIQAAKRTRRNIDASQLLDDGNADNYMDYADGMEEIFGSLNSLKLEIEQMK
HPLGTQHNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGETCIFPDKK
SEGARITSWPKENPGSWFSEFKRGKLLSYVDSDGNPIGVVQMTFLRLLSASARQNITYNC
YQSVAWHDATTNSYDKAIRFLGSNDEEMSYDNNPYIRAALDGCAARKGYQKTILEINTPK
VEQVPIVDIMFNDFGEAAQKFGFEVGPACFLG
Download sequence
Identical sequences H0Z6G1
ENSTGUP00000006159 ENSTGUP00000006159 59729.ENSTGUP00000006159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]