SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006163 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006163
Domain Number 1 Region: 147-342
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.87e-61
Family Astacin 0.0000753
Further Details:      
 
Domain Number 2 Region: 774-881
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-38
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 458-567
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 614-724
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-36
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 5 Region: 349-458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-36
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 6 Region: 905-999
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-27
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 7 Region: 722-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000599
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 8 Region: 570-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000357
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006163   Gene: ENSTGUG00000005951   Transcript: ENSTGUT00000006224
Sequence length 1009
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:31835147:31958298:1 gene:ENSTGUG00000005951 transcript:ENSTGUT00000006224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMLCWRMALWLAGWTVCGKPSSCSGLDYDYTYDFTEEDKAEAIDYKDPCKAAVFWGDIA
LDDEDLKIFQIDRTIDLTQHSNERLGHNTGGFGEHGMSKKHSALYQLIERIRRFGSGFEQ
NNTSKGRSSVKFSGKNEKNRYPRAATSRTERIWPGGVIPYVIGGNFTGTQRAMFKQAMRH
WEKYTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGH
VIGFWHEHTRPDRDDHVTIIRENIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTF
SRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESTGNFSSPG
FPNGYPSYTHCIWRISVTPGEKIILNFTTMDLYKSSLCWYDYIEVRDGYWRKSSLLGRFC
GDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIHKNEGQIQSPNYPDDYRP
MKECVWKITVSENYNVGLTFQAFEIERHDNCAYDYLEIRDGTNENSPLIGHFCGYDKPED
IRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDNGGCEQRCVNTLGSYQCACDPG
YELGPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPAQYRISMKFEFFE
LEGNEVCKYDYVEIRSGLSSDSKLHGKFCGTEVPEVITSQYNNMRIEFRSDNTVSKKGFK
AHFFSDKDECSKDNGGCQHECINTVGSYVCQCRNGFVLHENKHDCKEAECEQKIHSPNGI
ITSPNWPDKYPSRKECTWEISATPGQRVKLTFNEFEIEQHQECAYDHLEVFDGESEKSPI
LGRLCGNKIPDPLIATGNKMFLRFISDASVQRKGFQATHSTECGGRLKAELKPKDLYSHA
QFGDNNYPVQADCDWLLVAERGARVELMFQTFEVEEEADCGYDYVELFDGHDKTAVRLGR
FCGSGPPEEIYSAGESLLLHFHTDDTINKKGFHIRYRSIKYPGSVHTKK
Download sequence
Identical sequences H0Z6G5
59729.ENSTGUP00000006163 ENSTGUP00000006163 ENSTGUP00000006163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]