SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006169 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006169
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-32
Family Laminin G-like module 0.0042
Further Details:      
 
Domain Number 2 Region: 424-535
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000282
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 3 Region: 212-276
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000345
Family VWC domain 0.014
Further Details:      
 
Domain Number 4 Region: 376-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000102
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 636-708
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000764
Family VWC domain 0.014
Further Details:      
 
Domain Number 6 Region: 268-341
Classification Level Classification E-value
Superfamily FnI-like domain 0.000022
Family Fibronectin type I module 0.091
Further Details:      
 
Domain Number 7 Region: 541-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006169
Domain Number - Region: 342-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00664
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 575-642
Classification Level Classification E-value
Superfamily FnI-like domain 0.0356
Family VWC domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006169   Gene: ENSTGUG00000005974   Transcript: ENSTGUT00000006230
Sequence length 764
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:29636721:29751246:-1 gene:ENSTGUG00000005974 transcript:ENSTGUT00000006230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMFILDASRNVKASPETAEIFFQKLRNKCEFTILVTLKQAHLNSGVILSIHYLDHRYLEL
ESSGHRNEIRLHYRSGSHRSHTEVFPYILADDKWHRLSLAISASHLILHVDCNKIYERVV
EKPFMDLPLGTTFWLGQRNTAHGYFKGIMQDVQLLVMPQGFISQCPDLNRTCPTCNDFHG
LVQKIMELQDILAKTSAKLSQAEQRMNKLDQCYCERTCTMKGTTYREFESWTDGCKNCTC
MNGTVQCEALICPLAECPLNSALAYVDGKCCKECQSVCVFEGRTYFEGQRETVYSSSGDC
VLFECKDHKMQRIPKDICPALNCPESQQIPLSHSCCKVCKGHDFCTEGHNCMEHSVCRNL
EDRAVCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCVCKTGYIRID
DYSCTEHDECVTNQHNCDENALCFNTVGGHNCVCKPGYTGNGTICKAFCKDGCRNGGACI
ASNVCACPQGFTGPSCETETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFS
PSGESCEDIDECGTGRHSCANDTVCFNLDGGYDCRCPHGKNCTGDCIHEGKIKHNGQIWV
LENDRCSVCSCQKQNGYVMCRRMVCDCQNPTVDLFCCPECDPRLSSQCLHQSGEFSYNSG
DSWIQNCQQCRCLQGEVDCWPLPCPEVDCEFSVLPENECCPRCVTDPCQADTIRNDITKT
CLDETNVIRFTGSSWIKHGTECTLCQCKNGHVCCSVDPQCLQEL
Download sequence
Identical sequences H0Z6H1
ENSTGUP00000006169 59729.ENSTGUP00000006169 ENSTGUP00000006169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]