SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006195 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006195
Domain Number 1 Region: 155-278
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-27
Family Third domain of FERM 0.0045
Further Details:      
 
Domain Number 2 Region: 55-157
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-26
Family Second domain of FERM 0.0013
Further Details:      
 
Domain Number 3 Region: 1-55
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000971
Family First domain of FERM 0.0022
Further Details:      
 
Domain Number 4 Region: 353-402
Classification Level Classification E-value
Superfamily RING/U-box 0.00000424
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006195   Gene: ENSTGUG00000006026   Transcript: ENSTGUT00000006256
Sequence length 417
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:70273309:70286323:-1 gene:ENSTGUG00000006026 transcript:ENSTGUT00000006256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVCRRLGIIEVDYFGLQFTGNKGENLWLNLRNRISQQMDGLAPYRLKLRVKFFVEPHLIL
QEQTRHMFFLHIKEDLLAGNLQCSSEHAIELSALLAQMKFGDYNQNTAKYNYEELCAKEL
TTTILESIITKHKELEGLSQASAEYQLLQIVTTLENYGVEWHSVRDSEGQKLLIGVGPEG
ISICKDDFSPINRIAYPVVQMATQSGKNVYLTVTKESGNSVVLLFKMISTRAASGLYRAI
TETHAFYRCDTVTSAVMMQYSRDLKGHLASLFLNENINLGKKYVFDIKRTSKEVYDHARR
ALYNAGIVDLVSRSDQTPPSSPLKSSESSMNCDNCEGLSCQQTKALQEKLRKLKESMLCM
VCCEEEINSTFCPCGHTVCCKSCASQLQSCPVCRSRVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences H0Z6J7
ENSTGUP00000006195 ENSTGUP00000006195 59729.ENSTGUP00000006195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]