SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006206 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006206
Domain Number 1 Region: 463-582
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-26
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 131-241
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-22
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 237-357
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-20
Family Cadherin 0.0051
Further Details:      
 
Domain Number 4 Region: 572-680
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000014
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 43-137
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000757
Family Cadherin 0.0032
Further Details:      
 
Domain Number 6 Region: 350-467
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006206   Gene: ENSTGUG00000006019   Transcript: ENSTGUT00000006267
Sequence length 865
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:8706818:8749717:-1 gene:ENSTGUG00000006019 transcript:ENSTGUT00000006267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHVRHFTPSLFLSLVHVCLVQANYAPYFFDNGARSTNGNMALLSLSEDTPVGTHVYTLN
GTDPEGDPVTYGLTYEAGSRRYFSVDKNHGNVTLIEELDREKEDEIEVIVSISDGLSTVS
EKVRILVMDANDESPEFINTPYIVQVPENTPSSSSIFKVEAIDKDTGSGGSITYFLQNIH
TNKFTIDRHSGVLRIKPGVTLDYEKSRTHFVVVVAKDGGGKLRGDNKVFSATTTVTINVE
DVQDTPPMFIGTPYYGYVYEDTLAGSEVLTVVALDGDRGKPNSIHYCIVNGDEGSFEISN
TTGAISVIKSPNQLKKEVYELKVKASEVSQEGDISEYTFATVTIRVVDLNNHPPTFYGEN
GPQNRFELTMYEHPPEGEILRGLKITVSDSDQGANAKFNLRLVGPGGIFRVVPQTVLNEA
QVTIIVENSAAIDYESFKVLTFKLLAIEVNTPEKFSSTADVVIRLLDTNDNVPKFSSDYY
IARIPENSPGGSNVVAVTATDPDSGLWGEIKYSIYGTGADLFLIHPSTGIIYTQPWAVLD
AEVNSKYNFYVKAEDTDGKYSLAEVFITVLDVNDHSPEFNENIQEKTMIIGSPVKIEAID
QDAEEPNNIVDYSIMQADPANVFDIDQSTGEIKLKSYIRSLDIIHNITNNKDCIWSLVVQ
AKDRGSPSFSTTAVLKIDITEETLHKGPMAAFLMQTKDNPMKALGVLAGVMGIMVLITIM
ISTAMFWRNKRSNKVMPVRRIIKKRQMPPSRTVRMEWLKFKRPSNAAEKFVVEEDVKSLH
NENSNNNVQVVPVPPAAPLPPPPPALAPRGDAPGWQVPTVSGSLTPKHIIKPQKKKGHSS
THNALVSELKMRFEKRNAAFGEPHI
Download sequence
Identical sequences H0Z6K8
ENSTGUP00000006206 ENSTGUP00000006206 59729.ENSTGUP00000006206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]