SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006224 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006224
Domain Number 1 Region: 95-138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000161
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 2 Region: 65-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006224   Gene: ENSTGUG00000006050   Transcript: ENSTGUT00000006285
Sequence length 229
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:8832676:8839228:-1 gene:ENSTGUG00000006050 transcript:ENSTGUT00000006285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AESHLQPVYQPYLTTCQGHRLCSTYRTIYRVVYRQSSRQLAQPVASCCPGWSRANGHTLG
CNRALCWEPCQNGGSCAFPGRCSCPPGWTGQTCQTDVDECASQRHGCSQLCINTAGSFHC
ACRDGFSLAADDKGCQPLLPAPDTSSQAGASSEMKEEMKDLRSRVEALEQKLQLVLAPFY
NLMPPEDVGADPISRLSHSLQQLDRIDSLSEQISFLEERLETCKCLEKA
Download sequence
Identical sequences H0Z6M6
ENSTGUP00000006224 59729.ENSTGUP00000006224 ENSTGUP00000006224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]