SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006241 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006241
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-24
Family Ankyrin repeat 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006241   Gene: ENSTGUG00000006080   Transcript: ENSTGUT00000006304
Sequence length 120
Comment pep:novel chromosome:taeGut3.2.4:Z:67285879:67288826:-1 gene:ENSTGUG00000006080 transcript:ENSTGUT00000006304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REAFSRNSINPTRPLSLSTIHRKNVYGENLLHRAVIHQDINLVRRIIKAGGNVNAQDYAG
LTALHIASVEGFYQIANLLLKAGADVNATQKEQITPLQDAVKEGHYEVYSELNPKCDLGI
Download sequence
Identical sequences H0Z6P2
59729.ENSTGUP00000006241 ENSTGUP00000006241 ENSTGUP00000006241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]